Bug#349450: digikam: Rotation issue for write protected files ONLY
Package: digikam Version: 0.8.0-1-1 Followup-For: Bug #349450 I just realized that the EXIF info is only lost if digikam is owerwriting a originally write protected file. This still should not be happeneing in MHO. Either file is overwritten and EXIF info transfered, or we complain about write protection and do nothing, no? -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (550, 'unstable'), (500, 'testing'), (500, 'stable') Architecture: amd64 (x86_64) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-amd64-k8-smp Locale: LANG=en_US, LC_CTYPE=en_US (charmap=ISO-8859-1) Versions of packages digikam depends on: ii kdelibs4c2a 4:3.5.1-1 core libraries for all KDE applica ii libart-2.0-2 2.3.17-1 Library of functions for 2D graphi ii libaudio2 1.7-3 The Network Audio System (NAS). (s ii libc6 2.3.5-12 GNU C Library: Shared libraries an ii libexif12 0.6.12-2 library to parse EXIF files ii libfam0 2.7.0-9Client library to control the FAM ii libfontconfig12.3.2-1.1 generic font configuration library ii libfreetype6 2.1.10-1 FreeType 2 font engine, shared lib ii libgcc1 1:4.0.2-8 GCC support library ii libgphoto2-2 2.1.6-6gphoto2 digital camera library ii libgphoto2-port0 2.1.6-6gphoto2 digital camera port librar ii libice6 6.9.0.dfsg.1-4 Inter-Client Exchange library ii libidn11 0.5.18-1 GNU libidn library, implementation ii libimlib2 1.2.1-2powerful image loading and renderi ii libjpeg62 6b-11 The Independent JPEG Group's JPEG ii libkexif1 0.2.2-2library for KDE to read/display/ed ii libkipi0 0.1.2-2library for apps that want to use ii libpng12-01.2.8rel-5 PNG library - runtime ii libqt3-mt 3:3.3.5-3 Qt GUI Library (Threaded runtime v ii libsm66.9.0.dfsg.1-4 X Window System Session Management ii libsqlite3-0 3.2.8-1SQLite 3 shared library ii libstdc++64.0.2-8The GNU Standard C++ Library v3 ii libtiff4 3.8.0-1Tag Image File Format (TIFF) libra ii libx11-6 6.9.0.dfsg.1-4 X Window System protocol client li ii libxcursor1 1.1.3-1X cursor management library ii libxext6 6.9.0.dfsg.1-4 X Window System miscellaneous exte ii libxft2 2.1.8.2-2 FreeType-based font drawing librar ii libxi66.9.0.dfsg.1-4 X Window System Input extension li ii libxinerama1 6.9.0.dfsg.1-4 X Window System multi-head display ii libxrandr26.9.0.dfsg.1-4 X Window System Resize, Rotate and ii libxrender1 1:0.9.0.2-1X Rendering Extension client libra ii libxt66.9.0.dfsg.1-4 X Toolkit Intrinsics ii zlib1g1:1.2.3-9 compression library - runtime Versions of packages digikam recommends: ii digikamimageplugins 0.8.0-1-1+b1 image editor plugins for digikam a ii kdeprint4:3.5.1-1print system for KDE ii kipi-plugins0.1+rc1-1+b1 image manipulation/handling plugin ii konqueror 4:3.5.1-1KDE's advanced file manager, web b -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350710: [Yaird-devel] Bug#350710: yaird: With degenerated RAID1 boot fails trying to access second raid disk
On Tue, Jan 31, 2006 at 11:06:05AM -0500, RobRoy Kelly wrote: goto Template.cfg find the mdadm -assemble line and add --add that should start a degraded raid 1 on boot I know I can do that and also boot with ydebug and do it by hand. What I would like to see is fairlure proof code that can handle such things because I think that Debian should be able to handle such occasions without hassling with dash etc... just my 2 cents, if you don't think so, please close this report Philipp -- A byte walks into a bar and orders a pint. Bartender asks him What's wrong? Byte says Parity error. Bartender nods and says Yeah, I thought you looked a bit off. -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350863: kdeartwork-style - motif plus style missing
Package:kdeartwork-style Version:3.5.1-1 Architecture: amd64 Motif plus has dissappeared from list of available styles after upgrade to KDE 3.5. Please restore. -- David -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#74909: loan patti suter
Hi, suter patti We are accepting your loan app. Everything looks fine. http://ca.geocities.com/karlene12546leeland16316/ Please visit the web address above, so we can verify some things. Don't worry suter patti your history is not a factor. Best Regards, Mike -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#135972: rate bill altman
How have you been, altman bill We are accepting your loan application. Everything looks great. http://au.geocities.com/jefferson88585goldie20596/ Please visit the web address above, so we can verify some things. Don't worry altman bill your history is not a factor. Thank you, Pedro -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#348971: qa.debian.org: please consider converting PTS to a CSS layout
* Marc Haber: I want to check whether a given package has migrated from unstable to testing in a cron job, and this cron job should be able to run on a host that doesn't have a local archive. With the arrivale of Packages diffs, it's actually rather cheap (in terms of network bandwidth) to maintain a local mirror of the archive metadata. AFAICS, you only need the Sources files, so the disk space consumption shouldn't be an obstacle, either. -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#348971: qa.debian.org: please consider converting PTS to a CSS layout
On Wed, Feb 01, 2006 at 09:39:54AM +0100, Florian Weimer wrote: * Marc Haber: I want to check whether a given package has migrated from unstable to testing in a cron job, and this cron job should be able to run on a host that doesn't have a local archive. With the arrivale of Packages diffs, it's actually rather cheap (in terms of network bandwidth) to maintain a local mirror of the archive metadata. AFAICS, you only need the Sources files, so the disk space consumption shouldn't be an obstacle, either. Having never really understood the rather sparsely documented apt.conf syntax, I am reluctant to use apt to keep metadata current on a system without root privileges. Additionally, parsing the Sources file is another challenge. And again additionally, I don't want to get alerts just because my mirror is down or desynced. I was rather content with parsing packages.debian.org output. Greetings Marc -- - Marc Haber | I don't trust Computers. They | Mailadresse im Header Mannheim, Germany | lose things.Winona Ryder | Fon: *49 621 72739834 Nordisch by Nature | How to make an American Quilt | Fax: *49 621 72739835 -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350788: gnome-www-browser support
On Wed, Feb 01, 2006, Mike Hommey wrote: Is there a strong reason why this should be part of firefox-gnome-support and not just part of firefox? I'd say: because gnome-www-browser is something for gnome, and firefox-gnome-support is something for gnome. Yes, the goal is that the gnome-www-browser launches a browser well integrated with GNOME. -- Loïc Minier [EMAIL PROTECTED] Current Earth status: NOT DESTROYED
Bug#348971: qa.debian.org: please consider converting PTS to a CSS layout
* Marc Haber: With the arrivale of Packages diffs, it's actually rather cheap (in terms of network bandwidth) to maintain a local mirror of the archive metadata. AFAICS, you only need the Sources files, so the disk space consumption shouldn't be an obstacle, either. Having never really understood the rather sparsely documented apt.conf syntax, I am reluctant to use apt to keep metadata current on a system without root privileges. The secure-testing archive contains a self-contained reimplementation in Python with a very simple command-line interface (guess why). Additionally, parsing the Sources file is another challenge. The existing code should be sufficient; after all, you only need the Package and Version field. And again additionally, I don't want to get alerts just because my mirror is down or desynced. At least you can fix those problems yourself. If the PTS were down (like pdo at the monent), there wouldn't be much you could do about it. -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350865: apt: documentation references to apt-archive are wrong
Package: apt Version: 0.6.43.2 The some apt docs, namely the apt-secure manpage, have a reference to an apt-archive manpage which I think should be apt-ftparchive. The source also has a couple other references to apt-archive, apt-0.6.43.2$ rgrep 'apt-archive' * doc/apt-secure.8.xml:apt-conf;, apt-get;, sources-list;, apt-key;, apt-archive;, doc/apt.ent:!ENTITY apt-archive citerefentry doc/apt.ent:refentrytitlefilenameapt-archive/filename/refentrytitle doc/fr/apt-secure.fr.8.xml:apt-conf;, apt-get;,sources-list;, apt-key;, apt-archive;, debsign;, doc/fr/apt.ent.fr:!ENTITY apt-archive citerefentry doc/fr/apt.ent.fr:refentrytitlefilenameapt-archive/filename /refentrytitle Thanks, -- Matt Taggart [EMAIL PROTECTED] -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#345755: fglrx vs. xorg 6.9
Jon Ferguson wrote: I installed Joachim Breitner's packages, but ran into the problem described here. http://pepper.linuxfocus.org/~guido/gentoo-tpt43p/ Which problem? That page reports more than one. Please be more decriptive in your bug reports; pages you link to might disappear. If you mean the Bad page state at free_hot_cold_page error, you need the patch that Norbert applied in his NMU of fglrx-driver. It's also on the page you link to, although buried in a longer patch. See here: http://lkml.org/lkml/2005/12/11/26 Anyway, I have to point out what Joachim himself said: his packages are *not* built from the official debian sources, but from a hacked ATI installer, so don't report any problems here please. -- Ciao, Flavio -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350540: gnome-session: Long delay before Log Out dialog appears
Le mercredi 01 février 2006 à 15:06 +0800, Hongzheng Wang a écrit : Hi, The current processes list is: 8429 ?00:00:00 scim-launcher 8433 ?00:00:00 scim-helper-man 8434 ?00:00:00 scim-panel-gtk 8436 ?00:00:00 scim-launcher I don't know which process should be responsible for this problem. I also add a new user account which has not any per-user configuration to gnome system. Then I test it under that new account, but the problem is still there :( This is probably caused by scim. What happens if you disable it? -- .''`. Josselin Mouette/\./\ : :' : [EMAIL PROTECTED] `. `'[EMAIL PROTECTED] `- Debian GNU/Linux -- The power of freedom
Bug#350866: edit-json: has no dependencies declared
Package: edit-json Version: 0.4.0-1 Severity: serious Justification: Policy 3.5 edit-json seems to require quite a few things to work but the Depends field in the control file is simply missing. -- Michał Politowski Talking has been known to lead to communication if practiced carelessly. signature.asc Description: Digital signature
Bug#350867: skencil: wrong version number on the sketch conflict
Package: skencil Version: 0.6.17-2 Severity: normal skencil Conflicts: sketch ( 6.5.17) but the dummy package that should coexist peacefully with skencil is sketch 0.6.17-2 -- Michał Politowski Talking has been known to lead to communication if practiced carelessly. signature.asc Description: Digital signature
Bug#350868: unstable: kdeartwork-theme-icon: apt-get upgrade encountered errors
Package: kdeartwork-theme-icon Version: 4:3.5.1-1 Transscript of shell session follows. # date Mi Feb 1 09:54:51 CET 2006 # apt-get update # apt-get upgrade [...] Unpacking replacement kdeartwork-theme-icon ... dpkg: error processing /var/cache/apt/archives/kdeartwork-theme-icon_4%3a3.5.1-1_all.deb (--unpack): trying to overwrite `/usr/share/icons/hicolor/16x16/actions/view_fit_window.png', which is also in package kdelibs-data [...] Errors were encountered while processing: /var/cache/apt/archives/kdeartwork-theme-icon_4%3a3.5.1-1_all.deb E: Sub-process /usr/bin/dpkg returned an error code (1) # apt-get remove kdeartwork-theme-icon [...] The following packages will be REMOVED kde kdeartwork kdeartwork-theme-icon [...] Removing kdeartwork-theme-icon ... dpkg - warning: while removing kdeartwork-theme-icon, directory `/usr/share/icons/slick/48x48/filesystems' not empty so not removed. dpkg - warning: while removing kdeartwork-theme-icon, directory `/usr/share/icons/slick/48x48' not empty so not removed. dpkg - warning: while removing kdeartwork-theme-icon, directory `/usr/share/icons/slick' not empty so not removed. [...] # Regards, Tilman. -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350869: Unexpected behavior when expanding wildcards
Package: csh
Version: 20050313-1
Hi,
just noticed a strange effect when expanding wildcards and regexps:
This seems to be ok:
$ csh -c ls a/*/{hello_world,hello_world.c}
a/par_demo/hello_world a/par_demo/hello_world.c
Now adding a third alternative (which does not exist) gives this
unexpected result, no match at all:
$ csh -c ls a/*/{hello_world,hello_world.c,hello_world.f}
ls: No match.
tcsh works as expected:
$ tcsh -c ls a/*/{hello_world,hello_world.c,hello_world.f}
a/par_demo/hello_world a/par_demo/hello_world.c
Cheers, Thomas
--
To UNSUBSCRIBE, email to [EMAIL PROTECTED]
with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350870: libgtk2.0-0: file chooser does not work with symlinks
Package: libgtk2.0-0 Version: 2.8.10-1 Severity: normal When using a gtk program, in the file chooser, if I choose a symlink to a directory, the filechooser behaves as if it had changed directory, but does not show the files or directories in the target of the symlink. -- System Information: Debian Release: testing/unstable APT prefers testing APT policy: (990, 'testing'), (500, 'unstable'), (500, 'stable'), (1, 'experimental') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/dash Kernel: Linux 2.6.12-1-k7 Locale: LANG=C, LC_CTYPE=en_US.UTF-8 (charmap=UTF-8) Versions of packages libgtk2.0-0 depends on: ii libatk1.0-0 1.10.3-1The ATK accessibility toolkit ii libc62.3.5-8 GNU C Library: Shared libraries an ii libcairo21.0.2-3 The Cairo 2D vector graphics libra ii libfontconfig1 2.3.2-1.1 generic font configuration library ii libglib2.0-0 2.8.6-1 The GLib library of C routines ii libgtk2.0-bin2.8.10-1The programs for the GTK+ graphica ii libgtk2.0-common 2.8.10-1Common files for the GTK+ graphica ii libjpeg626b-11 The Independent JPEG Group's JPEG ii libpango1.0-01.10.2-1Layout and rendering of internatio ii libpng12-0 1.2.8rel-5 PNG library - runtime ii libtiff4 3.7.4-1 Tag Image File Format (TIFF) libra ii libx11-6 6.8.2.dfsg.1-11 X Window System protocol client li ii libxcursor1 1.1.3-1 X cursor management library ii libxext6 6.8.2.dfsg.1-11 X Window System miscellaneous exte ii libxi6 6.8.2.dfsg.1-11 X Window System Input extension li ii libxinerama1 6.8.2.dfsg.1-11 X Window System multi-head display ii libxrandr2 6.8.2.dfsg.1-11 X Window System Resize, Rotate and ii libxrender1 1:0.9.0.2-1 X Rendering Extension client libra Versions of packages libgtk2.0-0 recommends: ii hicolor-icon-theme0.8-3 default fallback theme for FreeDes -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#344029: DSA-960 - New bug possibly introduced
Hello,
The recent security update for libmail-audit-perl (DSA-960) appears to
have introduced a new bug. I have been using debian for several years now
and this is the first time that a security update turned out to be
problematic for me. Still an excellent track record in my book. :)
E-mail is often a touchy subject for a lot of people, so I thought I would
post the problem I encountered, which might be causing delivery problems
for other Debian/Mail::Audit users.
I am using Woody, Exim 3 and a perl script that make use of Mail::Audit. This
script executes as the mail user; the same user id under which Exim is running.
The problematic portion of the patch seems to be here:
-my $logfile = /tmp/.getpwuid($).-audit.log;
+my $logfile;
+if (exists $ENV{HOME} and defined $ENV{HOME} and -d $ENV{HOME}) {
+ $logfile = $ENV{HOME}/.mail_audit.log
+}
+else {
+ (undef,$logfile) = tempfile(mail_audit.log-X,TMPDIR=1);
+}
For reasons I haven't investigated, $ENV{HOME} is not being set when a
child process (my script) is spawned. This is causing the else clause to
be triggered, in the above logic. I further looked at the code for
File::Temp, and don't see any reference to a 'TMPDIR' option related to
the tempfile function. I also have determined that the cwd of my
executing script does not default to the mail user's home directory, but
to an unwritable directory (/) under which $logfile cannot be written to.
So instead of relying on the HOME environment variable being set, it could
possibly make more sense to use to do a getpwuid call for the UID present in $.
Below is a simple patch, but I'm sure there is more than one way to do it. I
didn't look in to how trustworthy $ is, but I think any serious risk is
mitigated with subsequent getpwuid call.
Thanks,
Brian Hodges
--- Audit.pmTue Jan 31 21:47:06 2006
+++ Audit-new.pmWed Feb 1 00:41:51 2006
@@ -6,17 +6,20 @@
use Sys::Hostname;
use vars qw($VERSION @ISA @EXPORT @EXPORT_OK);
use Fcntl ':flock';
-use File::Temp qw(tempfile);
use constant REJECTED = 100;
use constant DELIVERED = 0;
my $loglevel=3;
my $logging =0;
my $logfile;
-if (exists $ENV{HOME} and defined $ENV{HOME} and -d $ENV{HOME}) {
- $logfile = $ENV{HOME}/.mail_audit.log
-}
-else {
- (undef,$logfile) = tempfile(mail_audit.log-X,TMPDIR=1);
+
+# Home directory is in the 8th position
+my $home = (getpwuid($))[7];
+
+# If current user's homedirectory is writable, assign $logfile.
+# Otherwise if $logfile remains unassigned, code lower down will throw an
unhandled
+# exception if logging is on, err die that is.
+if (defined $home and -w $home) {
+ $logfile = $home/.mail_audit.log;
}
$VERSION = '2.0';
--
To UNSUBSCRIBE, email to [EMAIL PROTECTED]
with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#345825: libgl1-mesa-dri: Problem solved
Package: libgl1-mesa-dri Version: 6.4.1-0.1 Followup-For: Bug #345825 As I said, I also had this problem, but it has been solved now that Mesa 6.4.1 is in sid. So, maintainer, I think this can be closed. (I'll leave that up to you.) -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable'), (500, 'stable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-486 Locale: LANG=en_US, LC_CTYPE=en_US (charmap=ISO-8859-1) Versions of packages libgl1-mesa-dri depends on: ii libgl1-mesa-glx 6.4.1-0.1 A free implementation of the OpenG libgl1-mesa-dri recommends no packages. -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350113: some additional information
I also found this building openoffice upstream on a debian unstable sparc system. Checking DLL ../../unxlngs.pro/lib/check_libofficebean.so ...: ERROR: /usr/lib/libXft.so.2: undefined symbol: FT_GlyphSlot_Embolden A similar problem was found previously with libcairo2, see http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=325526 which describes a workaround and in turn refers to the explanation at libfreetype6 http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=316031 Jim -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350871: gedit: please add 'paste-column' feature
package: gedit severity: wishlist Hi! Please forward my wish to the gedit upstream authors to include a 'Paste Column'-feature to the 'Edit'-Menu like in NEDIT. Thank you very much! Nice greetings, Fabian -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350872: kdenetwork - FTBFS: error: prototype for 'int MeanwhileSession::handleSessionIOWrite(const guchar*, unsigned int)' does not match any in class 'MeanwhileSession'
Package: kdenetwork Version: 4:3.5.1-1 Severity: serious There was an error while trying to autobuild your package: Automatic build of kdenetwork_4:3.5.1-1 on debian-31 by sbuild/s390 85 [...] mkdir .libs g++ -DHAVE_CONFIG_H -I. -I/build/buildd/kdenetwork-3.5.1/./kopete/protocols/meanwhile -I../../.. -I/build/buildd/kdenetwork-3.5.1/./kopete/libkopete -I../../../kopete/libkopete -I/build/buildd/kdenetwork-3.5.1/./kopete/libkopete/avdevice -I/build/buildd/kdenetwork-3.5.1/./kopete/libkopete/ui -I../../../kopete/libkopete/ui -I/build/buildd/kdenetwork-3.5.1/./kopete/protocols/meanwhile/ui -I./ui -I/usr/include/kde -I/usr/share/qt3/include -I. -I/usr/include/meanwhile -I/usr/include/glib-2.0 -I/usr/lib/glib-2.0/include -DQT_THREAD_SUPPORT -D_REENTRANT -D_FILE_OFFSET_BITS=64 -Wno-long-long -Wundef -ansi -D_XOPEN_SOURCE=500 -D_BSD_SOURCE -Wcast-align -Wconversion -Wchar-subscripts -Wall -W -Wpointer-arith -DNDEBUG -DNO_DEBUG -O2 -g -Wall -O2 -Wformat-security -Wmissing-format-attribute -Wno-non-virtual-dtor -fno-exceptions -fno-check-new -fno-common -DQT_CLEAN_NAMESPACE -DQT_NO_ASCII_CAST -DQT_NO_STL -DQT_NO_COMPAT -DQT_NO_TRANSLATION -MT kopete_meanwhile_la.all_cpp.lo -MD -MP -MF .deps/kopete_meanwhile_la.all_cpp.Tpo -c kopete_meanwhile_la.all_cpp.cpp -fPIC -DPIC -o .libs/kopete_meanwhile_la.all_cpp.o /build/buildd/kdenetwork-3.5.1/./kopete/protocols/meanwhile/meanwhilesession.cpp:587: error: prototype for 'int MeanwhileSession::handleSessionIOWrite(const guchar*, unsigned int)' does not match any in class 'MeanwhileSession' /build/buildd/kdenetwork-3.5.1/./kopete/protocols/meanwhile/meanwhilesession.h:265: error: candidate is: int MeanwhileSession::handleSessionIOWrite(const guchar*, gsize) /build/buildd/kdenetwork-3.5.1/./kopete/protocols/meanwhile/meanwhileplugin.cpp:35: warning: unused parameter 'menu' make[6]: *** [kopete_meanwhile_la.all_cpp.lo] Error 1 make[6]: Leaving directory `/build/buildd/kdenetwork-3.5.1/obj-s390-linux-gnu/kopete/protocols/meanwhile' make[5]: *** [all-recursive] Error 1 make[5]: Leaving directory `/build/buildd/kdenetwork-3.5.1/obj-s390-linux-gnu/kopete/protocols/meanwhile' make[4]: *** [all-recursive] Error 1 make[4]: Leaving directory `/build/buildd/kdenetwork-3.5.1/obj-s390-linux-gnu/kopete/protocols' make[3]: *** [all-recursive] Error 1 make[3]: Leaving directory `/build/buildd/kdenetwork-3.5.1/obj-s390-linux-gnu/kopete' make[2]: *** [all-recursive] Error 1 make[2]: Leaving directory `/build/buildd/kdenetwork-3.5.1/obj-s390-linux-gnu' make[1]: *** [all] Error 2 make[1]: Leaving directory `/build/buildd/kdenetwork-3.5.1/obj-s390-linux-gnu' make: *** [debian/stamp-makefile-build] Error 2 ** Build finished at 20060131-1521 FAILED [dpkg-buildpackage died] gsize aka size_t is not unsinged int, it is size_t. Bastian
Bug#350873: digikam - FTBFS: libtool: link: `/usr/lib/libXft.la' is not a valid libtool archive
Package: digikam Version: 0.8.1-1 Severity: serious There was an error while trying to autobuild your package: Automatic build of digikam_0.8.1-1 on debian-31 by sbuild/s390 85 [...] ** Using build dependencies supplied by package: Build-Depends: debhelper ( 4.1), cdbs, kdelibs4-dev, libimlib2-dev, libexif-dev ( 0.6.9), libtiff4-dev, libgphoto2-2-dev, libkexif1-dev, libkipi0-dev, automake1.9, libsqlite3-dev [...] /bin/sh ../../../libtool --silent --tag=CXX --mode=link g++ -Wno-long-long -Wundef -ansi -D_XOPEN_SOURCE=500 -D_BSD_SOURCE -Wcast-align -Wconversion -Wchar-subscripts -Wall -W -Wpointer-arith -DNDEBUG -DNO_DEBUG -O2 -g -Wall -O2 -Wformat-security -Wmissing-format-attribute -Wno-non-virtual-dtor -fno-exceptions -fno-check-new -fno-common -DQT_CLEAN_NAMESPACE -DQT_NO_ASCII_CAST -DQT_NO_STL -DQT_NO_COMPAT -DQT_NO_TRANSLATION -DQT_CLEAN_NAMESPACE-o libjpegutils.la -L/usr/lib -L/usr/share/qt3/lib -L/usr/X11R6/lib libjpegutils_la.all_cpp.lo -ljpeg -lkexif grep: /usr/lib/libXft.la: No such file or directory /bin/sed: can't read /usr/lib/libXft.la: No such file or directory libtool: link: `/usr/lib/libXft.la' is not a valid libtool archive make[5]: *** [libjpegutils.la] Error 1 make[5]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu/digikam/libs/jpegutils' make[4]: *** [all-recursive] Error 1 make[4]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu/digikam/libs' make[3]: *** [all-recursive] Error 1 make[3]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu/digikam' make[2]: *** [all-recursive] Error 1 make[2]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu' make[1]: *** [all] Error 2 make[1]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu' make: *** [debian/stamp-makefile-build] Error 2 ** Build finished at 20060130-2209 FAILED [dpkg-buildpackage died] Bastian -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#344746: gnome-volume-manager: removable IDE devices are not automounted
On Tue, Jan 31, 2006 at 10:23:46PM +0100, Sjoerd Simons wrote: On Mon, Dec 26, 2005 at 01:01:48AM +1100, Hamish Moffatt wrote: Package: gnome-volume-manager Version: 1.2.1-1 Severity: normal I've got a removable IDE disk in the form of a compact flash card, which can be inserted in a PCMCIA slot via an adapter. The kernel recognises this as /dev/hde automatically, but it doesn't get automounted by gnome-volume-manager. Could you try this with the gvm and hal currently in unstable and see if the problem is still there? When I first upgraded to GNOME 2.12, I thought this seemed to be working, but it isn't now. I'll have to test again, which probably won't be till next week when I'm back in Australia near convenient email access. thanks, Hamish -- Hamish Moffatt VK3SB [EMAIL PROTECTED] [EMAIL PROTECTED] -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350874: kmymoney2 - FTBFS: error: kmymoney/export.h: No such file or directory
Package: kmymoney2 Version: 0.8.2-3 Severity: serious There was an error while trying to autobuild your package: Automatic build of kmymoney2_0.8.2-3 on debian01 by sbuild/s390 85 [...] /usr/share/qt3/bin/moc /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/kmymoneyregisterinvestment.h -o kmymoneyregisterinvestment.moc if g++ -DHAVE_CONFIG_H -I. -I/build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets -I../.. -I/usr/include/kde -I/usr/share/qt3/include -I. -DXTHREADS -I/usr/include/gtk-2.0 -I/usr/lib/gtk-2.0/include -I/usr/X11R6/include -I/usr/include/atk-1.0 -I/usr/include/pango-1.0 -I/usr/include/freetype2 -I/usr/include/glib-2.0 -I/usr/lib/glib-2.0/include -I/usr/include/qt3 -I/usr/include/kde -I/usr/include -I/build/buildd/kmymoney2-0.8.2/. -I. -DQT_THREAD_SUPPORT -D_REENTRANT -DKMM_DEBUG=0 -Wno-long-long -Wundef -ansi -D_XOPEN_SOURCE=500 -D_BSD_SOURCE -Wcast-align -Wconversion -Wchar-subscripts -Wall -W -Wpointer-arith -O2 -g -Wall -O2 -Wformat-security -Wmissing-format-attribute -Wno-non-virtual-dtor -fno-exceptions -fno-check-new -fno-common -fexceptions -MT kmymoneyregisterinvestment.o -MD -MP -MF .deps/kmymoneyregisterinvestment.Tpo -c -o kmymoneyregisterinvestment.o /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/kmymoneyregisterinvestment.cpp; \ then mv -f .deps/kmymoneyregisterinvestment.Tpo .deps/kmymoneyregisterinvestment.Po; else rm -f .deps/kmymoneyregisterinvestment.Tpo; exit 1; fi In file included from /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../widgets/../views/../mymoney/mymoneytransaction.h:36, from /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../widgets/../views/kmymoneytransaction.h:35, from /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../widgets/kmymoneyregister.h:46, from /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/kmymoneyregisterinvestment.h:37, from /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/kmymoneyregisterinvestment.cpp:34: /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../widgets/../views/../mymoney/mymoneyutils.h:33:29: error: kmymoney/export.h: No such file or directory In file included from /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/kmymoneyregisterinvestment.h:38, from /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/kmymoneyregisterinvestment.cpp:34: /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../mymoney/mymoneysecurity.h:43:35: error: kmymoney/mymoneymoney.h: No such file or directory /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../mymoney/mymoneysecurity.h:44:35: error: kmymoney/mymoneyutils.h: No such file or directory /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../mymoney/mymoneysecurity.h:45:47: error: kmymoney/mymoneykeyvaluecontainer.h: No such file or directory In file included from /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/kmymoneyregisterinvestment.cpp:35: /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../mymoney/mymoneyfile.h:34:38: error: kmymoney/imymoneystorage.h: No such file or directory /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../mymoney/mymoneyfile.h:35:39: error: kmymoney/mymoneyexception.h: No such file or directory /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../mymoney/mymoneyfile.h:37:41: error: kmymoney/mymoneyinstitution.h: No such file or directory /build/buildd/kmymoney2-0.8.2/./kmymoney2/widgets/../mymoney/mymoneyfile.h:38:37: error: kmymoney/mymoneyaccount.h: No such file or directory Bastian -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#336359: no automount for cd-writer using scsi-emulation
Unfortunately I cannot tell because I gave away this machine a month ago. Sorry for that Martin Seifert -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350190: mpd: Streams should not be paused, but stopped
Cc-ing upstream (Warren + dev mailing list) on this. Erich Schubert [EMAIL PROTECTED] wrote: Package: mpd Version: 0.11.5-5.1 Severity: normal Hi, I've added some internet radio streams to my mpd playlist, and I have a button linked to mpc toggle. While this button works perfectly with MP3s, it doesn't work properly with streams: MPC pauses the stream, and when you e.g. a few minutes later resume the stream it continues playing where it had stopped before; when the buffer is emptied the stream stops. Instead it should discard any outdated part of the buffer (read: with a two second buffer, when it was paused for one second it should discard the first second of the buffer) - usually all of the buffer - and then continue with the new data instead (i.e. reconnect etc.) This is definitely a problem mpd has with internet radio streams. The length of the pause is also taken into account, too; as short pauses (which may set your entire program back a few seconds) should be perfectly acceptable. What mpd should probably do after a long pause is to continue to play the buffered data, and then attempt to reopen the stream it was playing if the connection is dropped. For playback of static files over HTTP, full seeking/pausing should be supported. We just haven't gotten around to it. Perhaps there can be a pausable flag or have it somehow tied to the seekable flag. I ran into this while rewriting the HTTP code for the input-buffering thread in mpd-uclinux. Also I've had a couple of crashes with MPD and some web streams, but the one I had crashes with suddenly works fine for me now. Could you tell us which streams these are? Crashes shouldn't happen with mpd, ever. (ok, besides when using mikmod with corrupted files :). Any information in the logs would be very helpful, too. And it would be nice if MPD could playback this stream: mms://213.254.239.60/swr3$livestream.wma Totem can play that stream just fine (it's a german radio station, you can use it for testing, too; go to swr3.de and click on the live button in the upper right corner, which will eventually give you that URL above) mpd will support this when someone writes a Free, clean and orthogonal patch for it and Warren approves it. Last I checked, depending on large mega-frameworks like xine or gstreamer (either of which totem can use) is not option for MPD. I'm personally not interested in supporting proprietary codecs at all. -- Eric Wong signature.asc Description: Digital signature
Bug#350205: Fwd: Bug#350205: less: LC_CTYPE=zh_TW.Big5 vs. \xA0-\xFF
Hello Dan, may I close the report? Thomas --- Ursprüngliche Nachricht --- Von: Dan Jacobson [EMAIL PROTECTED] An: Mark Nudelman [EMAIL PROTECTED] Kopie: [EMAIL PROTECTED] Betreff: Bug#350205: Fwd: Bug#350205: less: LC_CTYPE=zh_TW.Big5 vs. \xA0-\xFF Datum: Wed, 01 Feb 2006 08:08:17 +0800 Mark Less does not support multibyte character sets, other than UTF-8. OK, the man page doesn't seem to say that very loudly... -- 10 GB Mailbox, 100 FreeSMS/Monat http://www.gmx.net/de/go/topmail +++ GMX - die erste Adresse für Mail, Message, More +++ -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350235: [EMAIL PROTECTED]: Re: Re: Bug#350235: ide pcmcia problem]
On Wed, Feb 01, 2006 at 03:08:42AM +0100, Kay Sievers wrote: What does udevtest print on your box? With or without the block/removable rule in place? With or without the CF card inserted? Greetings Marc -- - Marc Haber | I don't trust Computers. They | Mailadresse im Header Mannheim, Germany | lose things.Winona Ryder | Fon: *49 621 72739834 Nordisch by Nature | How to make an American Quilt | Fax: *49 621 72739835 -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350336: ITP: latex-mk -- tool for managing LaTeX projects
* Vincent Danjean [EMAIL PROTECTED] [2006-01-31 20:21]: Nevertheless, you can be interesting by looking at my work. If you want, all is available here : http://dept-info.labri.fr/~danjean/deb.html#latex-utils Indeed, your package looks very interesting. Do you have plans to make it an official Debian package? When it is done, I will mention latex-utils in the latex-mk description (BTW, latex-mk is already in the NEW queue, see http://ftp-master.debian.org/new.html). Unfortunately, I have no time to investigate latex-utils , and ltex-mk is fulfilling my needs for now. From a quick look at the files in latex-utils, I see: /usr/include/LaTeX.mk Is this an appropriate place for this file? The FHS says: /usr/include : Directory for standard include files. Purpose This is where all of the system's general-use include files for the C programming language should be placed. [see http://www.pathname.com/fhs/pub/fhs-2.3.html#USRINCLUDEDIRECTORYFORSTANDARDINCLU] I think a better place would be: /usr/share/latex-utils/LaTeX.mk Best regards, -- Rafael -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350851: (no subject)
I've reported two grave bugs against kmail with dIMAP a few months ago. Those bugs are reported to upstream but still open. http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=321102 http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=332473 Regards, Bastian -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350875: failure to create ramfs does not abort configuration of kernel image
Package: initramfs-tools Version: 0.51 Severity: important If I configure a kernel image, using mkinitramfs for the initrd, and /boot runs full, the kernel is still configured: cirrus:~# dpkg-reconfigure linux-image-2.6.15-1-k7 Running depmod. Finding valid ramdisk creators. Using mkinitramfs to build the ramdisk. gzip: stdout: No space left on device Running postinst hook /sbin/update-grub. Searching for GRUB installation directory ... found: /boot/grub . Examining /etc/kernel/postinst.d. cirrus:~# dpkg -l linux-image-2.6.15-1-k7 | grep \^ii ii linux-image-2.6.15-1-k7 2.6.15-3 Linux kernel 2.6.15 image on AMD K7 machines This results in a kernel panic on next boot (ran out of compressed data). mkinitrd used to handle this situation correctly, leaving the kernel image package in an unconfigured state. -- .''`. martin f. krafft [EMAIL PROTECTED] : :' :proud Debian developer and author: http://debiansystem.info `. `'` `- Debian - when you have better things to do than fixing a system Invalid/expired PGP (sub)keys? Use subkeys.pgp.net as keyserver! funny how just when you think life can't possibly get any worse it suddenly does. -- marvin signature.asc Description: Digital signature (GPG/PGP)
Bug#350876: log_daemon_msg: command not found
Package: bluetooth Version: 2.24-1 Upon /etc/init.d/bluetooth start, I got an error message saying .line 176: log_daemon_msg: command not found (i don't remember what was before the line 176) searching on the web, i found this: http://lists.alioth.debian.org/pipermail/pkg-lighttpd-maintainers/2005-December/19.html which seemed to be the problem. installing the current unstable version of lsb-base fixed it. so i recommend that the dependency be updated to require a sufficiently recent version of lsb-base thanks, bayle -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#321359: rhythmbox: Gaps in playback of mp3s with low sample rates
Loïc Minier wrote: Since a few days (I'm not totally sure when this started) rhythmbox causes many gaps (about two per second) in the playback of mp3s with sample rates of 22.05 or 24 kHz. 44.1 and 48 kHz work fine. I *know* that this worked before. I can provide you with mp3s with this behaviour. GStreamer 0.8 has seen a lot of ALSA fixes, and sampling rates fixes, could you five GStreamer plugins 0.8.11-6 a try with Rhythmbox 0.9.2? Works now. Thanks! Greetings, Aaron -- Aaron Isotton | http://www.isotton.com/ I'll give you a definite maybe. --Samuel Goldwyn signature.asc Description: OpenPGP digital signature
Bug#350235: [EMAIL PROTECTED]: Re: Re: Bug#350235: ide pcmcia problem]
On Feb 01, Marc Haber [EMAIL PROTECTED] wrote: On Wed, Feb 01, 2006 at 03:08:42AM +0100, Kay Sievers wrote: What does udevtest print on your box? With or without the block/removable rule in place? With or without the CF card inserted? With the rule and the card. -- ciao, Marco signature.asc Description: Digital signature
Bug#350877: udev: udev upgrade breaks networking without warning
Package: udev Version: 0.083-1 Severity: important As explained in bug #350183, installing new udev version can break networking. This should be clearly documented in NEWS.Debian -- when I upgraded udev, I didn't find this very important information there and after the next reboot my network connection didn't work. Regards, Milan Zamazal -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350878: ITP: kernel-patch-realtime-preempt --
Package: wnpp Severity: wishlist * Package name: kernel-patch-realtime-preempt Version : 2.6.15+rt12 Upstream Author : Ingo Molnar * URL or Web page : http://people.redhat.com/mingo/realtime-preempt/ * License : GPL Description : realtime preemption patch This package provides a kernel patch for the realtime kernel scheduler.The patch was written an is maintained by Ingo Molnar and Arjan van de Ven and aims to fix all latency sources that generate higher than ~1 msec latencies. -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#341772: quodlibet: severe memory leak
On Tue, Jan 31, 2006, dann frazier wrote: Or the fact that its ia64... Oops. I asked some GStreamer folks running on amd64 to run the pipeline under valgrind/amd64, but they don't see the problem, so it seems it's purely ia64. I don't have specific ideas on how to debug this further, I could suggest using the debugging environment variables, that's all I think of now. -- Loïc Minier [EMAIL PROTECTED] Current Earth status: NOT DESTROYED
Bug#350879: linux-image-2.6.15-1-k7: ide-floppy does not create hdx4 device for iomega ATA zip drive
Package: linux-image-2.6.15-1-k7 Version: 2.6.15-3 Severity: normal This is what dmesg says: VP_IDE: IDE controller at PCI slot :00:04.1 VP_IDE: chipset revision 16 VP_IDE: not 100% native mode: will probe irqs later VP_IDE: VIA vt82c686a (rev 22) IDE UDMA66 controller on pci:00:04.1 ide0: BM-DMA at 0xd800-0xd807, BIOS settings: hda:DMA, hdb:DMA ide1: BM-DMA at 0xd808-0xd80f, BIOS settings: hdc:pio, hdd:pio ... hdd: IOMEGA ZIP 100 ATAPI, ATAPI FLOPPY drive ide1 at 0x170-0x177,0x376 on irq 15 ... ide-floppy driver 0.99.newide hdd: No disk in drive hdd: 98304kB, 32/64/96 CHS, 4096 kBps, 512 sector size, 2941 rpm ... hdd: No disk in drive Warning: /proc/ide/hd?/settings interface is obsolete, and will be removed soon! hdd: No disk in drive ... hdd: 98304kB, 196608 blocks, 512 sector size hdd: hdd4 ... -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable'), (99, 'experimental') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-k7 Locale: LANG=C, LC_CTYPE=C (charmap=ANSI_X3.4-1968) Versions of packages linux-image-2.6.15-1-k7 depends on: ii module-init-tools 3.2.2-1tools for managing Linux kernel mo ii yaird [linux-initramfs-tool] 0.0.12-3 Yet Another mkInitRD Versions of packages linux-image-2.6.15-1-k7 recommends: pn libc6-i686none (no description available) -- debconf information: linux-image-2.6.15-1-k7/postinst/depmod-error-initrd-2.6.15-1-k7: false linux-image-2.6.15-1-k7/postinst/old-initrd-link-2.6.15-1-k7: true linux-image-2.6.15-1-k7/preinst/abort-install-2.6.15-1-k7: linux-image-2.6.15-1-k7/postinst/create-kimage-link-2.6.15-1-k7: true linux-image-2.6.15-1-k7/postinst/depmod-error-2.6.15-1-k7: false linux-image-2.6.15-1-k7/postinst/kimage-is-a-directory: linux-image-2.6.15-1-k7/preinst/lilo-has-ramdisk: linux-image-2.6.15-1-k7/preinst/failed-to-move-modules-2.6.15-1-k7: * linux-image-2.6.15-1-k7/preinst/overwriting-modules-2.6.15-1-k7: false linux-image-2.6.15-1-k7/postinst/old-system-map-link-2.6.15-1-k7: true linux-image-2.6.15-1-k7/postinst/bootloader-error-2.6.15-1-k7: * linux-image-2.6.15-1-k7/preinst/already-running-this-2.6.15-1-k7: linux-image-2.6.15-1-k7/preinst/initrd-2.6.15-1-k7: linux-image-2.6.15-1-k7/preinst/elilo-initrd-2.6.15-1-k7: true linux-image-2.6.15-1-k7/postinst/old-dir-initrd-link-2.6.15-1-k7: true linux-image-2.6.15-1-k7/postinst/bootloader-test-error-2.6.15-1-k7: linux-image-2.6.15-1-k7/preinst/abort-overwrite-2.6.15-1-k7: linux-image-2.6.15-1-k7/preinst/lilo-initrd-2.6.15-1-k7: true linux-image-2.6.15-1-k7/prerm/would-invalidate-boot-loader-2.6.15-1-k7: true linux-image-2.6.15-1-k7/preinst/bootloader-initrd-2.6.15-1-k7: true linux-image-2.6.15-1-k7/prerm/removing-running-kernel-2.6.15-1-k7: true -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350747: stunnel: fails to start
Hi I wanted to file a similar bug... What worked for me was regenerating the certificate and key (though I put them in the same file) after upgrading to stunnel4. I hope this helps. Cheers Luk -- Luk Claes - http://people.debian.org/~luk - GPG key 1024D/9B7C328D Fingerprint: D5AF 25FB 316B 53BB 08E7 F999 E544 DE07 9B7C 328D signature.asc Description: OpenPGP digital signature
Bug#350880: failure to create ramfs does not abort configuration of kernel image
Package: yaird Version: 0.0.12-3 Severity: important If I configure a kernel image, using yaird for the initrd, and /boot runs full, the kernel is still configured: cirrus:~# dpkg-reconfigure linux-image-2.6.15-1-k7 Running depmod. Finding valid ramdisk creators. Using mkinitrd.yaird to build the ramdisk. yaird error: Could not copy /lib/tls/libc-2.3.5.so to /boot/initrd.img-2.6.15-1-k7.new.7behkOlAU1rVENze/lib/tls/libc-2.3.5.so (fatal) mkinitrd.yaird failed to create initrd image. Failed to create initrd image. cirrus:~# dpkg -l linux-image-2.6.15-1-k7 | grep \^ii ii linux-image-2.6.15-1-k7 2.6.15-3 Linux kernel 2.6.15 image on AMD K7 machines This results in a kernel panic on next boot (ran out of compressed data). mkinitrd used to handle this situation correctly, leaving the kernel image package in an unconfigured state. -- .''`. martin f. krafft [EMAIL PROTECTED] : :' :proud Debian developer and author: http://debiansystem.info `. `'` `- Debian - when you have better things to do than fixing a system Invalid/expired PGP (sub)keys? Use subkeys.pgp.net as keyserver! funny how just when you think life can't possibly get any worse it suddenly does. -- marvin signature.asc Description: Digital signature (GPG/PGP)
Bug#349857: linux-image-2.6-sparc64-2.6.15-1-sparc64: panics on boot on v210
maximilian attems [EMAIL PROTECTED] writes: That gets it further, but then it fails as follows (where sda1 is /boot). If I then get in single-user, I see /dev/sda1 mounted on /, but there is no /dev/sd*, i.e. no sd devices, which looks odd. please try latest klibc-utils and libklibc from incoming.debian.org or later this evening in unstable, calling update-initramfs -u will get those on your initramfs. Does that mean I should file a bug against yaird, which was what failed as above? -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350881: sweep: errors displaying gettexted messages
Package: sweep Version: 0.9.0-2 Severity: normal Hello, There is something wrong probably with localized messages when using locales pl_PL. All messages which contain non-ascii characters are truncated I made: $ export LC_ALL=pl_PL.utf8 $ sweep and after that everythin was ok. You can see the difference on included screenshots. I was trying to investinge this problem. I made $ msgunfmt /usr/share/locale/pl/LC_MESSAGES/sweep.mo but everything seems to be OK here. -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-686 Locale: LANG=pl_PL, LC_CTYPE=pl_PL (charmap=ISO-8859-2) Versions of packages sweep depends on: ii libasound21.0.10-2 ALSA library ii libatk1.0-0 1.10.3-1 The ATK accessibility toolkit ii libc6 2.3.5-11 GNU C Library: Shared libraries an ii libcairo2 1.0.2-3The Cairo 2D vector graphics libra ii libesd-alsa0 0.2.36-3 Enlightened Sound Daemon (ALSA) - ii libfontconfig12.3.2-1.1 generic font configuration library ii libglib2.0-0 2.8.6-1The GLib library of C routines ii libgtk2.0-0 2.8.10-1 The GTK+ graphical user interface ii libmad0 0.15.1b-2.1MPEG audio decoder library ii libogg0 1.1.3-2Ogg Bitstream Library ii libpango1.0-0 1.10.2-1 Layout and rendering of internatio ii libsamplerate00.1.2-2audio rate conversion library ii libsndfile1 1.0.12-3 Library for reading/writing audio ii libspeex1 1.1.11.1-1 The Speex Speech Codec ii libvorbis0a 1.1.2-1The Vorbis General Audio Compressi ii libvorbisenc2 1.1.2-1The Vorbis General Audio Compressi ii libvorbisfile31.1.2-1The Vorbis General Audio Compressi ii libx11-6 6.9.0.dfsg.1-1 X Window System protocol client li ii libxcursor1 1.1.3-1X cursor management library ii libxext6 6.9.0.dfsg.1-1 X Window System miscellaneous exte ii libxi66.9.0.dfsg.1-2 X Window System Input extension li ii libxinerama1 6.9.0.dfsg.1-1 X Window System multi-head display ii libxrandr26.9.0.dfsg.1-1 X Window System Resize, Rotate and ii libxrender1 1:0.9.0.2-1X Rendering Extension client libra Versions of packages sweep recommends: pn cmt none (no description available) pn fil-plugins none (no description available) pn ladspa-plugin none (no description available) pn mcp-plugins none (no description available) pn swh-plugins none (no description available) pn tap-plugins none (no description available) -- no debconf information sweep_iso8859-2.png Description: PNG image sweep_utf8.png Description: PNG image
Bug#350883: tsclient: fails to build from source
Package: tsclient Version: 0.140-2 Severity: grave Justification: renders package unusable Hello, After * apt-get source tsclient * cd tsclient-0.140 * dpg-checkbuilddeps and installing the missing lib-dev * fakeroot debian/rules binary I get: test -x debian/rules test `id -u` = 0 dh_clean -k dh_installdirs -A if [ -n ]; then \ mkdir -p ; \ fi if [ ! -d . ]; then \ mkdir -p .; \ fi /usr/share/cdbs/1/rules/buildcore.mk:116: DEB_BUILD_MAKE_TARGET is a deprecated variable /usr/share/cdbs/1/rules/buildcore.mk:116: DEB_CLEAN_MAKE_TARGET is a deprecated variable /usr/share/cdbs/1/rules/buildcore.mk:116: DEB_MAKE_TEST_TARGET is a deprecated variable if [ -z ]; then \ if ! test -f debian/compat; then echo 4 debian/compat; fi; \ fi GCONF_DISABLE_MAKEFILE_SCHEMA_INSTALL=1 make -C . make[1]: Entering directory `/usr/src/tsclient-0.140' make all-recursive make[2]: Entering directory `/usr/src/tsclient-0.140' Making all in src make[3]: Entering directory `/usr/src/tsclient-0.140/src' make[3]: Nothing to be done for `all'. make[3]: Leaving directory `/usr/src/tsclient-0.140/src' Making all in applet make[3]: Entering directory `/usr/src/tsclient-0.140/applet' cc -DHAVE_CONFIG_H -I. -I. -I.. -DPACKAGE_DATA_DIR=\/usr/share\ -DPACKAGE_LOCALE_DIR=\/usr/share/locale\-DXTHREADS -DORBIT2=1 -pthread -I/usr/include/panel-2.0 -I/usr/include/gtk-2.0 -I/usr/include/libgnomeui-2.0 -I/usr/include/libbonoboui-2.0 -I/usr/lib/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/pango-1.0 -I/usr/X11R6/include -I/usr/include/glib-2.0 -I/usr/lib/glib-2.0/include -I/usr/include/libgnome-2.0 -I/usr/include/libgnomecanvas-2.0 -I/usr/include/libart-2.0 -I/usr/include/gconf/2 -I/usr/include/orbit-2.0 -I/usr/include/libbonobo-2.0 -I/usr/include/gnome-vfs-2.0 -I/usr/lib/gnome-vfs-2.0/include -I/usr/include/bonobo-activation-2.0 -I/usr/include/freetype2 -I/usr/include/libxml2 -g -Wall -O2 -c applet.c In file included from /usr/include/panel-2.0/panel-applet.h:37, from applet.c:23: /usr/include/panel-2.0/GNOME_Panel.h:40: error: syntax error before 'struct' /usr/include/panel-2.0/GNOME_Panel.h:84: error: syntax error before 'struct' /usr/include/panel-2.0/GNOME_Panel.h:182: error: syntax error before 'struct' /usr/include/panel-2.0/GNOME_Panel.h:211: error: syntax error before 'struct' /usr/include/panel-2.0/GNOME_Panel.h:240: error: syntax error before 'struct' /usr/include/panel-2.0/GNOME_Panel.h:267: error: syntax error before 'struct' applet.c: In function 'tsclient_applet_create': applet.c:68: warning: unused variable 'i' applet.c: In function 'create_menu': applet.c:170: warning: assignment discards qualifiers from pointer target type applet.c:183: warning: assignment from incompatible pointer type applet.c: In function 'applet_popup_hide': applet.c:261: warning: unused variable 'vol' applet.c: In function 'applet_menu_item': applet.c:279: warning: unused variable 'dialog' make[3]: *** [applet.o] Error 1 make[3]: Leaving directory `/usr/src/tsclient-0.140/applet' make[2]: *** [all-recursive] Error 1 make[2]: Leaving directory `/usr/src/tsclient-0.140' make[1]: *** [all-recursive-am] Error 2 make[1]: Leaving directory `/usr/src/tsclient-0.140' make: *** [debian/stamp-makefile-build] Error 2 How can I help to fix this FTBFS ? -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable') Architecture: powerpc (ppc) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.8-powerpc Locale: LANG=en_US, LC_CTYPE=en_US (charmap=ISO-8859-1) Versions of packages tsclient depends on: ii libatk1.0-0 1.10.3-1The ATK accessibility toolkit ii libbonoboui2-0 2.10.1-1The Bonobo UI library ii libc62.3.5-11GNU C Library: Shared libraries an ii libglib2.0-0 2.8.6-1 The GLib library of C routines ii libgnome2-0 2.10.1-1The GNOME 2 library - runtime file ii libgnomeui-0 2.10.1-1The GNOME 2 libraries (User Interf ii libgtk2.0-0 2.8.10-1The GTK+ graphical user interface ii libpanel-applet2-0 2.12.2-3library for GNOME 2 panel applets ii rdesktop 1.4.1-1.0.1 RDP client for Windows NT/2000 Ter tsclient recommends no packages. -- no debconf information - End forwarded message - -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350882: wvdialconf doesnt write modem settings to /etc/wvdial.conf
Package: wvdial Version: 1.55-1 Severity: grave Justification: renders package unusable During install and afterward running wvdialconf doesnt actually save modem settings/strings. ISP info is saved, but nothing else. -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.14.2 Locale: LANG=en_AU, LC_CTYPE=en_AU (charmap=ISO-8859-1) Versions of packages wvdial depends on: ii debconf 1.4.70 Debian configuration management sy ii libc6 2.3.5-12 GNU C Library: Shared libraries an ii libuniconf4.2 4.2.2-2C++ network libraries for rapid ap ii libwvstreams4.2-base 4.2.2-2C++ network libraries for rapid ap ii libwvstreams4.2-extras4.2.2-2C++ network libraries for rapid ap ii libxplc0.3.13 0.3.13-1 Light weight component system ii ppp 2.4.4b1-1 Point-to-Point Protocol (PPP) daem wvdial recommends no packages. -- debconf information excluded -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350885: pilot-link: [INTL:da] Updated Danish debconf translation
Package: pilot-link Severity: wishlist Tags: patch l10n Please use the attached updated Danish debconf translation (debian/po/da.po) -- System Information: Debian Release: testing/unstable APT prefers stable APT policy: (900, 'stable'), (100, 'unstable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15 Locale: LANG=da_DK, LC_CTYPE=da_DK (charmap=ISO-8859-1) # translation of da.po to Danish # translation of pilot-link debconf to Danish # # Claus Hindsgaul [EMAIL PROTECTED], 2004, 2006. msgid msgstr Project-Id-Version: da\n Report-Msgid-Bugs-To: [EMAIL PROTECTED] POT-Creation-Date: 2005-11-29 22:24+0100\n PO-Revision-Date: 2006-02-01 11:48+0100\n Last-Translator: Claus Hindsgaul [EMAIL PROTECTED]\n Language-Team: Danish [EMAIL PROTECTED]\n MIME-Version: 1.0\n Content-Type: text/plain; charset=UTF-8\n Content-Transfer-Encoding: 8bit\n X-Generator: KBabel 1.11.1\n #. Type: select #. Choices #: ../pilot-link.templates:3 msgid None, ttyS0, ttyS1, ttyS2, ttyS3, ircomm0, ttyUSB0, ttyUSB1 msgstr Ingen, ttyS0, ttyS1, ttyS2, ttyS3, ircomm0, ttyUSB0, ttyUSB1 #. Type: select #. Description #: ../pilot-link.templates:4 msgid Communication port to use with the Palm: msgstr Hvilken kommunikationsport skal bruges med din Palm: #. Type: select #. Description #: ../pilot-link.templates:4 msgid A symbolic file /dev/pilot may be created to the port use to talk to the Palm. msgstr Der bliver oprettet en symbolsk lænke fra /dev/pilot til den port, der skal bruges til at snakke med din Palm. #. Type: select #. Description #: ../pilot-link.templates:4 msgid ttyS? are the four serial ports, ircomm0 is the IrDA (infra red) port, ttyUSB? are the USB ports. msgstr ttyS? er fire serielle porte, ircomm0 er IrDA-porten (infrarød), ttyUSB? er USB-portene. #. Type: select #. Description #: ../pilot-link.templates:4 msgid To ease the use of the Palm connected to the port its access rights will be lowered to allow access to any user. If it is a security problem for you, select \None\ and manage the link and its access rights yourself. msgstr For at lette brugen af den Palm, der er forbundet til porten, vil dennes adgangsrettigheder blive øget, så enhver bruger får adgang til den. Hvis det er et sikkerhedsproblem for dig, så vælg \Ingen\ og håndtér selv lænken og adgangsrettighederne.
Bug#350884: manpages-dev: document that msgbuf is only defined when _GNU_SOURCE is defined
Package: manpages-dev Version: 2.17-1 Severity: minor Hi, struct msgbuf is only defined in linux/msg.h if __USE_GNU is defined, i.e. if the programmer has defined _GNU_SOURCE. But the manpage doesn't document that. #define _GNU_SOURCE should be added before #include sys/types.h #include sys/ipc.h #include sys/msg.h int msgsnd(int msqid, struct msgbuf *msgp, size_t msgsz, int msgflg); ssize_t msgrcv(int msqid, struct msgbuf *msgp, size_t msgsz, long msg- typ, int msgflg); Regards, Samuel -- System Information: Debian Release: testing/unstable APT prefers testing APT policy: (900, 'testing'), (500, 'unstable'), (500, 'stable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15 Locale: [EMAIL PROTECTED], [EMAIL PROTECTED] (charmap=ISO-8859-15) Versions of packages manpages-dev depends on: ii manpages 2.17-1 Manual pages about using a GNU/Lin manpages-dev recommends no packages. -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#236706: qingy
Hello. Any news on packaging qingy? regards fEnIo -- ,''`. Bartosz Fenski | mailto:[EMAIL PROTECTED] | pgp:0x13fefc40 | irc:fEnIo : :' : 32-050 Skawina - Glowackiego 3/15 - w. malopolskie - Poland `. `' phone:+48602383548 | proud Debian maintainer and user `- http://skawina.eu.org | jid:[EMAIL PROTECTED] | rlu:172001 -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#316131: signing-party: photoID on fingerprint-slips
Hoi Jacob, It would be nice if a photoID (if present) will also be printed on the fingerprint-slips. That would surely be nice. However, the image is in JPEG format, so it would require some converting-magic and some postscript-fiddling to get done. If you (or anyone else) want to come up with a patch for this, that would be very welcome. Thijs signature.asc Description: This is a digitally signed message part
Bug#333832: signing-party: Signing with multiple keys incompletely supported
Hello Peter,
+ for my $mykey (@{$CONFIG{'keyid'}}) {
This is not the way it's supposed to be, so this patch should not be
applied.
There are other, clean and nice ways, to do what Erich wants, and we
will probably implement them some day, hopefully RSN.
You seem to have an idea about the 'right' solution here. Maybe you can
go into a bit of detail (or fix it yourself ofcourse :)?
Thijs
signature.asc
Description: This is a digitally signed message part
Bug#350103: Please update debconf PO translation for the package glibc 2.3.5-13
Attached is an updated Danish translation.
- Morten.
#
#Translators, if you are not familiar with the PO format, gettext
#documentation is worth reading, especially sections dedicated to
#this format, e.g. by running:
# info -n '(gettext)PO Files'
# info -n '(gettext)Header Entry'
#
#Some information specific to po-debconf are available at
#/usr/share/doc/po-debconf/README-trans
# or http://www.debian.org/intl/l10n/po-debconf/README-trans
#
#Developers do not need to manually edit POT or PO files.
#
msgid
msgstr
Project-Id-Version: glibc-2.3.2.ds1\n
Report-Msgid-Bugs-To: [EMAIL PROTECTED]
POT-Creation-Date: 2006-01-23 17:33+0100\n
PO-Revision-Date: 2006-02-01 10:36+0200\n
Last-Translator: Morten Brix Pedersen [EMAIL PROTECTED]\n
Language-Team: Danish [EMAIL PROTECTED]\n
MIME-Version: 1.0\n
Content-Type: text/plain; charset=UTF-8\n
Content-Transfer-Encoding: 8bit\n
#. Type: multiselect
#. Description
#: ../debhelper.in/locales.templates:4
msgid Locales to be generated:
msgstr Lokalitetsfiler der skal genereres:
#. Type: multiselect
#. Description
#: ../debhelper.in/locales.templates:4
msgid
Locale is a framework to switch between multiple languages for users who can
select to use their language, country, characters, collation order, etc.
msgstr
Lokalitetsfilerne er lavet så du kan skifte imellem forskellige sprog til
til dit Debian system.
#. Type: multiselect
#. Description
#: ../debhelper.in/locales.templates:4
msgid
Choose which locales to generate. The selection will be saved to `/etc/
locale.gen', which you can also edit manually (you need to run `locale-gen'
afterwards).
msgstr
Vælg hvilke lokaliteter der skal genereres. Dine valg vil blive gemt til '/
etc/locale.gen', som du også kan redigere manuelt (du skal køre 'locale-gen'
bagefter.
#. Type: select
#. Choices
#: ../debhelper.in/locales.templates:14
msgid None, ${locales}
msgstr Ingen, ${locales}
#. Type: select
#. Description
#: ../debhelper.in/locales.templates:16
msgid Default locale for the system environment:
msgstr Standard lokalitet til systemmiljøet:
#. Type: select
#. Description
#: ../debhelper.in/locales.templates:16
msgid
Many packages in Debian use locales to display text in the correct language
for users. You can change the default locale if you're not a native English
speaker. These choices are based on which locales you have chosen to
generate.
msgstr
Mange pakker i Debian bruger lokaliteter til at vise tekst i det korrekt
sprog til brugerne. Du kan ændre standard-lokaliteten hvis engelsk ikke er
dit modersmåls sprog. Dine valg er baseret på hvilke lokalitetsfiler du
valgte at generere.
#. Type: select
#. Description
#: ../debhelper.in/locales.templates:16
msgid
Note: This will select the language for your whole system. If you're running
a multi-user system where not all of your users speak the language of your
choice, then they will run into difficulties and you might want not to set a
default locale.
msgstr
Bemærk: Dette vil sætte sproget for hele systemet. Hvis ikke alle brugerne
på dit system kan forstå det sprog som du vælger, kan de løbe ind i
problemer.
Bug#350886: manpages-fr: please update translation of waitpid(2)
Package: manpages-fr Version: 1.67.0-1 Severity: normal Hi, The translation of the NOTES paragraph wasn't updated, though it contains very important information about wait() and waitpid() behavior with 2.6 kernels... There are a lot of such missing translation updates, I'm really considering uninstalling my manpages-fr package... Regards, Samuel -- System Information: Debian Release: testing/unstable APT prefers testing APT policy: (900, 'testing'), (500, 'unstable'), (500, 'stable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15 Locale: [EMAIL PROTECTED], [EMAIL PROTECTED] (charmap=ISO-8859-15) -- no debconf information -- Samuel Thibault [EMAIL PROTECTED] Actually, typing random strings in the Finder does the equivalent of filename completion. (Discussion in comp.os.linux.misc on the intuitiveness of commands: file completion vs. the Mac Finder.) -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#345999: installation-report: Same problem on a Dell Latitude D610
Mensaje citado por Pelayo Gonzalez [EMAIL PROTECTED]: Mensaje citado por Frans Pop [EMAIL PROTECTED]: Thanks for your work on this. You welcome!. We will discuss the option of adding this in modprobe.conf somehow. Main questions there are: - when to do it - do we want to do it by default or only if reading the CD without the option fails My 2 cents: Before CDROM detection, check if there are an ATAPI CDROM conected to SATA: if test `lsmod | grep '^libata' then # There are one or more ATAPI devices disabled? if [ `dmesg | grep -q '^ata.*WARNING: ATAPI is disabled, device ignored.$'` ] then rmmod all_the_modules_that_depend_on_libata rmmod libata echo 'options libata atapi_enabled=1' /etc/modprobe.d modprobe libata modprobe all_the_modules_that_depend_on_libata LIBATA_HAS_ATAPI=1 else LIBATA_HAS_ATAPI=0 fi fi Continue CDROM detection. - can we somehow make sure the option is also available after rebooting into the installed system Before kernel install: if [ $LIBATA_HAS_ATAPI ]; then echo 'options libata atapi_enabled=1' /target/etc/modprobe.d/libata fi I hope yaird will pass the option to the initrd. I haven't got time to switch from Ubuntu to Debian yet, so I'm can't try this now. Saludos Pelayo -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350873: digikam - FTBFS: libtool: link: `/usr/lib/libXft.la' is not a valid libtool archive
On Wednesday 01 February 2006 10:25, Bastian Blank wrote: Package: digikam Version: 0.8.1-1 Severity: serious There was an error while trying to autobuild your package: Hi Bastian, this is not a digikam problem. libXt-dev contains no longer a libXt.la file. So every -dev pkgs that has a .la file refering to libXt.la makes every other pkg, that build-depend on it, FTBFS. AFAIU the disappearance of libXt.la is intentional. So all pkg with with references in libXt.la, need (just) a rebuild to get rid of the reference of libXt.la. I'll do some more checks later and reassing/merge as appropriate. Achim Automatic build of digikam_0.8.1-1 on debian-31 by sbuild/s390 85 [...] ** Using build dependencies supplied by package: Build-Depends: debhelper ( 4.1), cdbs, kdelibs4-dev, libimlib2-dev, libexif-dev ( 0.6.9), libtiff4-dev, libgphoto2-2-dev, libkexif1-dev, libkipi0-dev, automake1.9, libsqlite3-dev [...] /bin/sh ../../../libtool --silent --tag=CXX --mode=link g++ -Wno-long-long -Wundef -ansi -D_XOPEN_SOURCE=500 -D_BSD_SOURCE -Wcast-align -Wconversion -Wchar-subscripts -Wall -W -Wpointer-arith -DNDEBUG -DNO_DEBUG -O2 -g -Wall -O2 -Wformat-security -Wmissing-format-attribute -Wno-non-virtual-dtor -fno-exceptions -fno-check-new -fno-common -DQT_CLEAN_NAMESPACE -DQT_NO_ASCII_CAST -DQT_NO_STL -DQT_NO_COMPAT -DQT_NO_TRANSLATION -DQT_CLEAN_NAMESPACE-o libjpegutils.la -L/usr/lib -L/usr/share/qt3/lib -L/usr/X11R6/lib libjpegutils_la.all_cpp.lo -ljpeg -lkexif grep: /usr/lib/libXft.la: No such file or directory /bin/sed: can't read /usr/lib/libXft.la: No such file or directory libtool: link: `/usr/lib/libXft.la' is not a valid libtool archive make[5]: *** [libjpegutils.la] Error 1 make[5]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu/digikam/libs/jpegutils' make[4]: *** [all-recursive] Error 1 make[4]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu/digikam/libs' make[3]: *** [all-recursive] Error 1 make[3]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu/digikam' make[2]: *** [all-recursive] Error 1 make[2]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu' make[1]: *** [all] Error 2 make[1]: Leaving directory `/build/buildd/digikam-0.8.1/obj-s390-linux-gnu' make: *** [debian/stamp-makefile-build] Error 2 ** Build finished at 20060130-2209 FAILED [dpkg-buildpackage died] Bastian -- To me vi is Zen. To use vi is to practice zen. Every command is a koan. Profound to the user, unintelligible to the uninitiated. You discover truth everytime you use it. -- [EMAIL PROTECTED] -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350887: wmacpi: libdockapp appears to be hijacking command line options
Package: wmacpi Version: 2.1-4 Severity: important $ wmacpi -r wmacpi: unrecognized option '-r' Usage: wmacpi [OPTIONS] There is no help available -h, --help shows this help text and exit -v, --versionshows program version and exit -w, --windowed runs the application in windowed mode $ wmacpi -h wmacpi - help [EMAIL PROTECTED] -d display display on remote display display -b enable blinking of various UI elements -r disable scrolling message -c valueset critical low alarm at value percent (default: 10 percent) -m battery number battery number to monitor -s sample ratenumber of times per minute to sample battery information default 20 (once every three seconds) -f force the use of capacity mode for calculating time remaining -n do not blink -w run in command line mode -a samplessamples to average over (cli mode only) -v increase verbosity can be used multiple times to increase verbosity further -h display this help $ wmacpi -w On AC Power; Battery BAT0 charging, currently at 70%, 0:30 remaining $ wmacpi -v 2.1 $ -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable'), (500, 'testing'), (500, 'stable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-686 Locale: LANG=en_GB, LC_CTYPE=en_GB (charmap=ISO-8859-1) Versions of packages wmacpi depends on: ii libc6 2.3.5-12 GNU C Library: Shared libraries an ii libdockapp2 1:0.5.0-1.2Window Maker Dock App support (sha ii libx11-6 6.9.0.dfsg.1-4 X Window System protocol client li ii libxext6 6.9.0.dfsg.1-4 X Window System miscellaneous exte ii libxpm4 6.9.0.dfsg.1-4 X pixmap library Versions of packages wmacpi recommends: ii wmaker0.92.0-5.2 NeXTSTEP-like window manager for X -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350888: dhcdbd: description improvement
Package: dhcdbd Version: 1.10-1 Severity: wishlist Tags: patch Hi! Searching for this package with the search terms dbus dhcp fails because the description mentions only dhclient. I would propose to change the description to this: Description: dbus interface to the ISC DHCP client dhcdbd provides a dbus interface to dhclient, the DHCP client from ISC, so applications such as NetworkManager can query and control dhclient. This allows an application neutral interface for such operations Regards, David -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-3+suspend2.2-p4-1 Locale: LANG=C, LC_CTYPE=de_AT.UTF-8 (charmap=UTF-8) Versions of packages dhcdbd depends on: ii dbus 0.60-5 simple interprocess messaging syst ii dhcp3-client 3.0.3-6DHCP Client ii libc6 2.3.5-12 GNU C Library: Shared libraries an ii libdbus-1-2 0.60-5 simple interprocess messaging syst dhcdbd recommends no packages. -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350889: pure-ftpd-mysql: any problems with a home dir will allow rw to the entire filesystem
Package: pure-ftpd-mysql Version: 1.0.19-4 Severity: normal Tags: security If anything bad happens to an user's home directory (deleted, not mounted, database not in sync with its master, etc), pure-ftpd will allow r to the entire filesystem, and w to whatever place the given user can write to (and since virtual users usually don't have separate Unix uids, thus typically home dirs of all other virtual accounts). And on a system with no untrusted local users, many private dirs tend to be world-readable. The ftp daemon should obviously deny access instead of granting it when not configured to allow so. A sample session: Connected to 10.0.2.2. 220-- Welcome to Pure-FTPd [privsep] [TLS] -- 220-You are user number 1 of 50 allowed. 220-Local time is now 11:31. Server port: 21. 220-This is a private system - No anonymous login 220-IPv6 connections are also welcome on this server. 220 You will be disconnected after 15 minutes of inactivity. Name (10.0.2.2:kilobyte): 331 User kilobyte OK. Password required Password: 230-/home/ftp/dealerzy/kilobyte does not exist or is unreachable [No such file or directory]. 230-Starting in / 230-User kilobyte has group access to: dealerzy 230 OK. Current directory is / Remote system type is UNIX. Using binary mode to transfer files. ftp ls 200 PORT command successful 150 Connecting to port 22208 drwxr-xr-x2 0root 2048 Jan 10 18:42 bin drwxr-xr-x3 0root 1024 Jan 10 18:27 boot [...] -- System Information: Debian Release: 3.1 Architecture: i386 (i686) Kernel: Linux 2.6.8-2-686 Locale: LANG=C, LC_CTYPE=C (charmap=ANSI_X3.4-1968) Versions of packages pure-ftpd-mysql depends on: ii libc6 2.3.2.ds1-22 GNU C Library: Shared libraries an ii libcap11:1.10-14 support for getting/setting POSIX. ii libmysqlclient10 3.23.56-3 LGPL-licensed client library for M ii libpam0g 0.76-22 Pluggable Authentication Modules l ii libssl0.9.70.9.7e-3sarge1SSL shared libraries ii pure-ftpd-common 1.0.19-4 Pure-FTPd FTP server (Common Files ii zlib1g 1:1.2.2-4.sarge.2 compression library - runtime -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#318076: just the wrong place
You can make small temporary workaround for this bug by: $ export PKG_CONFIG_PATH=/usr/X11R6/lib/pkgconfig -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350890: krusader segfaults on some directories
Package: krusader Version: 1.60.0-3.1 Severity: serious Krusader segfaults when enterig some directory. Krusader crashes when I go into home dir of one of users. So it seems this directory contains files that are causing krusader to crash. Some programs are somtimes reporting something about UTF8 and file encoding there. ii kdelibs3.5.1-1 ii kdelibs-bin3.5.1-1 ii kdelibs-data 3.5.1-1 ii kdelibs4-dev 3.5.1-1 ii kdelibs4-doc 3.5.0-3 ii kdelibs4c2a3.5.1-1 (no debugging symbols found) Using host libthread_db library /lib/tls/i686/cmov/libthread_db.so.1. (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) [Thread debugging using libthread_db enabled] [New Thread -1235871520 (LWP 1372)] (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) [KCrash handler] #6 0x08126c66 in QStrList::~QStrList () #7 0xb6d352df in QListViewPrivate::SortableItem::cmp () from /usr/lib/libqt-mt.so.3 #8 0xb6d35327 in QListViewPrivate::SortableItem::operator () from /usr/lib/libqt-mt.so.3 #9 0xb6d363a6 in qHeapSortPushDownQListViewPrivate::SortableItem () from /usr/lib/libqt-mt.so.3 #10 0xb6d365ff in qHeapSortHelperQListViewPrivate::SortableItem*, QListViewPrivate::SortableItem () from /usr/lib/libqt-mt.so.3 #11 0xb6d366a0 in qHeapSortQListViewPrivate::SortableItem* () from /usr/lib/libqt-mt.so.3 #12 0xb6d327c6 in QListViewItem::sortChildItems () from /usr/lib/libqt-mt.so.3 #13 0xb6d1d20b in QListViewItem::enforceSortOrder () from /usr/lib/libqt-mt.so.3 #14 0xb6d1c448 in QListView::firstChild () from /usr/lib/libqt-mt.so.3 #15 0xb74f0d14 in KListView::setSorting () from /usr/lib/libkdeui.so.4 #16 0x08129da0 in QStrList::~QStrList () #17 0x0811260c in QPtrListKFileItem::~QPtrList () #18 0x08113bfe in QPtrListKFileItem::~QPtrList () #19 0x0811c71d in QPtrListKFileItem::~QPtrList () #20 0xb6c28b57 in QObject::activate_signal () from /usr/lib/libqt-mt.so.3 #21 0xb6c2963b in QObject::activate_signal () from /usr/lib/libqt-mt.so.3 #22 0x0813bf9d in QValueListPrivateKURL::remove () #23 0x0813c0b8 in QValueListPrivateKURL::remove () #24 0x08109be7 in QBitmap::~QBitmap () #25 0x0810a0c8 in QBitmap::~QBitmap () #26 0x0810b7aa in QBitmap::~QBitmap () #27 0xb6c28b57 in QObject::activate_signal () from /usr/lib/libqt-mt.so.3 #28 0xb6c2963b in QObject::activate_signal () from /usr/lib/libqt-mt.so.3 #29 0xb6fbad21 in QTimer::timeout () from /usr/lib/libqt-mt.so.3 #30 0xb6c4e0b4 in QTimer::event () from /usr/lib/libqt-mt.so.3 #31 0xb6bbe698 in QApplication::internalNotify () from /usr/lib/libqt-mt.so.3 #32 0xb6bbe8b6 in QApplication::notify () from /usr/lib/libqt-mt.so.3 #33 0xb7308fde in KApplication::notify () from /usr/lib/libkdecore.so.4 #34 0xb6b4e5e5 in QApplication::sendEvent () from /usr/lib/libqt-mt.so.3 #35 0xb6baf98c in QEventLoop::activateTimers () from /usr/lib/libqt-mt.so.3 #36 0xb6b6235c in QEventLoop::processEvents () from /usr/lib/libqt-mt.so.3
Bug#350861: [Yaird-devel] Bug#350861: yaird: Degraded RAID 1 array fails to boot
On Tue, 31 Jan 2006 23:13:55 -0700 Shaun Jackman [EMAIL PROTECTED] wrote: If yaird is run while the root partition, a RAID 1 array, is in a degraded state, the system will not boot if the array is ever restored to a complete state. I installed a new kernel (linux-image-2.6.15-1-k7). I did not notice at the time that /dev/md0, a RAID 1 array and my root partition, was degraded; 1 of 2 disks were online. When yaird was run in the kernel postinst, it generated an initrd that added only the one online disk to the array. Some time later I noticed that the array was degraded and add added the missing disk back to the array. Now 2 of 2 disk are online. I rebooted the system, but the initrd only tried to add the one disk to the array, and mdadm refused to start the array, since it had only 1 disk, and apparently it really wanted 2. It pointed out that one may pass the --run option to force it to start, but of course I had no console or shell with which to pass this option. So, it'd be better if the initrd built by yaird included *all* the disks for the array, including failed disks. Perhaps it could check this information against /etc/mdadm/mdadm.conf if it exists. Second, it'd be much better if the initrd would start the array even with a failed disk, which suggests passing the --run option to mdadm. This latter point probably requires some discussion first. I believe including broken disks will then fail to boot the degraded system (if not including --run). See bug#350710. Upstream dislikes including config files with the initrd. As I understand it for the reason that the initrd should then probably be rebuild whenever the original config file is changed. Why do including --add require more discussion? What is the drawbacks? See also bug#336514 for a related issue. thanks for the help with this. - Jonas -- * Jonas Smedegaard - idealist og Internet-arkitekt * Tlf.: +45 40843136 Website: http://dr.jones.dk/ - Enden er nær: http://www.shibumi.org/eoti.htm pgp19UsrNGShx.pgp Description: PGP signature
Bug#350686: Don't wok wish terminus
Anton Zinoviev wrote: On Tue, Jan 31, 2006 at 12:12:23PM +0300, Olleg Samoylov wrote: Thanks for reporting this problem. It is caused by the fact that version 0.9-12 of console-cyrillic is incompatible with version 4.14-1 of console-terminus. You have to upgrade console-terminus to version 4.16-2. And you have to add correct dependence in package. :) -- Olleg Samoylov smime.p7s Description: S/MIME Cryptographic Signature
Bug#303342: A different solution for Exim4 integration
On 30/01/2006 19:38, Lionel Elie Mamane wrote: Not with virtual domains: The mailing lists are present on all domains. Okay, I seem to be out of my depth. There are issues I wasn't aware of. With respect to your previous message: On 12/11/2005 18:29, Lionel Elie Mamane wrote: It is slightly edited from my production configuration. The only thing that worries me is that I run with MAILMAN_GID=list, and so does the submitter. Everything works, yet multiple sources say that this should match the argument to --with-mail-gid, namely daemon (so I've put that in this draft). Could somebody comment on that? I couldn't find any mailman-related file owned by group daemon and the daemons run with gid list (and not daemon, even not as a supplementary group), too. Could someone comment on that? It feels weird to me. There's a description of how this is meant to work in the second to last paragraph of (but you probably know this) http://www.python.org/cgi-bin/faqw-mm.py?req=showfile=faq06.016.htp However, because of debian/patches/10_wrapper_uid.dpatch, Debian Mailman doesn't check the gid if it's less than 100 or equal to 65534. The reason for this is partly explained in bugs #36010 and #89848. As a result probably neither the values of --with-mail-gid nor MAILMAN_GID matter very much. Roger -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#347650: libtool: Incorrect argument reordering
Sorry for not answering earlier, my previous mail was eaten by a spam filter, presumably because of the huge traces. Le mercredi 11 janvier 2006 à 22:38 +0100, Ralf Wildenhues a écrit : The following version (which was used for GNOME 2.10) isn't affected: VERSION=1.5.6 TIMESTAMP= (1.1220.2.95 2004/04/11 05:50:42) BTW I have had the occasion to build a library that uses version 1.5.16, which is affected as well. Now this strikes me as strange. I don't remember all development from 1.5.6 on; it would make my life easier if you could run ../../libtool --debug ... for both versions and post the output (packed), together with .../libtool --config You can find these outputs at: http://malsain.org/~joss/libtool/ Regards, -- .''`. Josselin Mouette/\./\ : :' : [EMAIL PROTECTED] `. `'[EMAIL PROTECTED] `- Debian GNU/Linux -- The power of freedom
Bug#348525: control-center - FTBFS: cannot find -ldbus-1
Le mardi 31 janvier 2006 à 05:32 -0800, Steve Langasek a écrit : I think we can downgrade this bug to non-RC as the symptom shouldn't occur anymore or is using a crummy version of libtool considered RC these days ? Well, in some cases it is: control-center is one of the packages affected by http://lists.debian.org/debian-devel-announce/2005/11/msg00016.html as it depends on libfreetype6 without a build-dependency, which probably means it doesn't use it. Since we know at this point that libfreetype6 is going away in the etch time frame, it is RC for etch that gnome-control-center be built without a dependency on libfreetype6: either by using a newer libtool or -Wl,--as-needed to drop the dependency now, or by rebuilding against the new libfreetype when it's available. I urge you not to wait for the latter. Relibtoolising doesn't help because of pkg-config. In fact, control-center's upstream already uses the Debian patched libtool. Furthermore, --as-needed doesn't work because of libtool bug #347650. I'm afraid we have to wait for the new libfreetype unless libtool is fixed. Regards, -- .''`. Josselin Mouette/\./\ : :' : [EMAIL PROTECTED] `. `'[EMAIL PROTECTED] `- Debian GNU/Linux -- The power of freedom
Bug#350891: cedar-backup2-doc: /usr/share/doc-base/cedar-backup2-interface is also in package cedar-backup2
Package: cedar-backup2-doc Version: 2.7.2-2 Severity: important cedar-backup2-doc 2.7.2-2 conflicts with cedar-backup2 2.7.2-1 (both packages install /usr/share/doc-base/cedar-backup2-interface). The proper requirements/conflics need to be added to the packages. -- Install Log: Unpacking cedar-backup2-doc (from .../cedar-backup2-doc_2.7.2-2_all.deb) ... dpkg: error processing /var/cache/apt/archives/cedar-backup2-doc_2.7.2-2_all.deb (--unpack): trying to overwrite `/usr/share/doc-base/cedar-backup2-interface', which is also in package cedar-backup2 Errors were encountered while processing: /var/cache/apt/archives/cedar-backup2-doc_2.7.2-2_all.deb -- System Information: Debian Release: testing/unstable APT prefers testing APT policy: (990, 'testing'), (900, 'stable'), (700, 'unstable'), (100, 'experimental') Architecture: i386 (i686) -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#294585: Bye bye inetd
The current BitlBee development version has a new daemon-mode, one that fork()s off a process for every client. This gets rid of the inetd dependency and has some of the daemon advantages (even though it still fills up the process list a bit more, but that's just something we can't avoid for now, without getting too many stability issues), including inter-Bee-communication. :-) I can't close these bugs yet, I don't know when this stuff will be ready for a release. If it takes a few months, I'll try to fix at least some of these bugs, but I'd rather close them all at once by introducing ForkDaemon. Wilmer. -- + .''`. - -- ---+ +- -- --- - --+ | wilmer : :' : gaast.net | | OSS Programmer www.bitlbee.org | | lintux `. `~' debian.org | | Full-time geek wilmer.gaast.net | +--- -- - ` ---+ +-- - --- -- -+ signature.asc Description: Digital signature
Bug#346285: bug fixed in matplotlib 0.83
This bug is fixed by 0.83 and later release, so upgrading to a new upstream release should be enough to fix the problem. -- Alexandre Fayolle LOGILAB, Paris (France). http://www.logilab.com http://www.logilab.fr http://www.logilab.org Retrait du projet de loi DADVSI: http://eucd.info/petitions/index.php?petition=2 signature.asc Description: Digital signature
Bug#350686: Don't wok wish terminus
On Wed, Feb 01, 2006 at 02:11:41PM +0300, Olleg Samoylov wrote: Anton Zinoviev wrote: On Tue, Jan 31, 2006 at 12:12:23PM +0300, Olleg Samoylov wrote: Thanks for reporting this problem. It is caused by the fact that version 0.9-12 of console-cyrillic is incompatible with version 4.14-1 of console-terminus. You have to upgrade console-terminus to version 4.16-2. And you have to add correct dependence in package. :) Yes. :-) Anton Zinoviev -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350797: openjade: Fails on entity definitions in xml-iso-entities-*
severity 350797 minor thanks Thanks for your quick reaction. On Wednesday 01 February 2006 04:26, you wrote: The problem is that in order to resolve a long standing performance problem, I turned off DTDDECL handling in the the libosp5 package on which openjade depends. What this means is that you need to explicitly specify the XML declaration before the document: /usr/bin/openjade -t tex -b utf-8 -o build.tmp/install.en.tex \ -d /home/fjp/projects/manual-build/manual/build/stylesheets/style-print.dsl \ -V tex-backend declaration/xml.dcl build.tmp/install.en.profiled.xml ^^^ This works for me. This is a reversion back to an older (pre-Sarge) form of the command. I think this is a small price to pay for the huge performance gain (a factor of 10-20), but let me know if it is not an option for you; if so, I'll consider reinstating the behavior as it was in Sarge. Please consider documenting this change in NEWS.Debian with your next upload. Leaving the report open for that. The performance gain is indeed impressive. Here are some results for the Installation Guide: $ time ./buildone.sh i386 en pdf Info: creating temporary profiled .xml file... Info: creating temporary .tex file... Info: creating temporary .dvi file... Info: creating .pdf file... real0m45.286s user0m43.041s sys 0m2.427s upgrade to new openjade $ time ./buildone.sh i386 en pdf Info: creating temporary profiled .xml file... Info: creating temporary .tex file... Info: creating temporary .dvi file... Info: creating .pdf file... real0m24.491s user0m24.252s sys 0m0.451s -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350892: mydms: Can't configure package
Package: mydms Version: 1.4.4+1-1 Severity: important The configuration script for the package, asks if I want it to install a database. After answering yes, I get the error: ERROR 1045 (28000): Access denied for user 'root'@'localhost' (using password: YES) James -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable'), (500, 'stable'), (1, 'experimental') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.13 Locale: LANG=C, LC_CTYPE=C (charmap=ANSI_X3.4-1968) Versions of packages mydms depends on: ii apache2 2.0.55-4 next generation, scalable, extenda ii apache2-mpm-prefork [apache2] 2.0.55-4 traditional model for Apache2 ii dbconfig-common 1.8.11 common framework for packaging dat ii debconf [debconf-2.0] 1.4.58 Debian configuration management sy ii libapache2-mod-php4 4:4.4.2-1 server-side, HTML-embedded scripti ii libphp-adodb 4.64-4 The 'adodb' database abstraction l ii mysql-client-5.0 [mysql-clien 5.0.18-7 mysql database client binaries ii mysql-server 5.0.18-7 mysql database server (current ver ii mysql-server-5.0 [mysql-serve 5.0.18-7 mysql database server binaries ii php4-gd 4:4.4.2-1 GD module for php4 ii php4-mysql4:4.4.2-1 MySQL module for php4 mydms recommends no packages. -- debconf information: mydms/dbconfig-upgrade: true mydms/dbconfig-remove: true mydms/performing_upgrade: false mydms/import-oldsettings: mydms/remote/port: mydms/upgrade-error: abort mydms/remote/newhost: mydms/dbconfig-install: true mydms/install-error: abort mydms/passwords-do-not-match: mydms/remove-error: abort mydms/mysql/method: unix socket mydms/db/dbname: mydms mydms/mysql/admin-user: root mydms/database-type: mydms/upgrade-backup: true mydms/purge: false mydms/db/app-user: mydms mydms/remote/host: -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350893: control socket not working with svn+ssh
Package: ssh Version: 1:4.2p1-5 Severity: normal This may well be a bug in subversion, but I am filing it against SSH because the control socket functionality is very new and the subversion folks may not know about it yet. The following should explain it all: the socket is not removed after the svn connection was tunneled via SSH: cirrus:~/coding/libhid svn up [30] At revision 295. cirrus:~/coding/libhid svn up [31] Control socket connect(/home/madduck/.ssh/var/ssh_control_gaia.ailab.ch_22_krafft): Connection refused ControlSocket /home/madduck/.ssh/var/ssh_control_gaia.ailab.ch_22_krafft already exists svn: Connection closed unexpectedly -- System Information: Debian Release: testing/unstable APT prefers stable APT policy: (700, 'stable'), (600, 'testing'), (98, 'unstable'), (1, 'experimental') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-686 Locale: LANG=en_GB, LC_CTYPE=en_GB.UTF-8 (charmap=UTF-8) Versions of packages ssh depends on: ii openssh-client1:4.2p1-5 Secure shell client, an rlogin/rsh ii openssh-server1:4.2p1-5 Secure shell server, an rshd repla ssh recommends no packages. -- debconf-show failed -- .''`. martin f. krafft [EMAIL PROTECTED] : :' :proud Debian developer and author: http://debiansystem.info `. `'` `- Debian - when you have better things to do than fixing a system Invalid/expired PGP (sub)keys? Use subkeys.pgp.net as keyserver! 'this must be a thursday,' said arthur to himself, sinking low over his beer. 'i never could get the hang of thursdays.' -- hitchhiker's guide to the galaxy signature.asc Description: Digital signature (GPG/PGP)
Bug#350089: xemacs21: Problem with savehist/exit.
Hi, What flavor of xemacs21 do you use? -mule or -nomule? I had used nomule. With mule this problem does not appear. Thanks, Alexander -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350895: python2.3-twisted-runner: Conflict with python2.3-twisted-bin
Package: python2.3-twisted-runner Version: 0.1.0-1 Severity: serious Justification: Policy 7.5.1 Unpacking python2.3-twisted-runner (from .../python2.3-twisted-runner_0.1.0-1_i386.deb) ... dpkg: error processing /var/cache/apt/archives/python2.3-twisted-runner_0.1.0-1_i386.deb (--unpack): trying to overwrite `/usr/lib/python2.3/site-packages/twisted/runner/portmap.so', which is also in package python2.3-twisted-bin $ dpkg -l python2.3-twisted-bin ||/ NameVersion Description +++-===-===-== ii python2.3-twisted-bin 2.0.1-5 Event-based framework for internet applications -- System Information: Debian Release: testing/unstable APT prefers testing APT policy: (990, 'testing'), (500, 'unstable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-k7 Locale: LANG=en_GB, [EMAIL PROTECTED] (charmap=ISO-8859-15) -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350897: cgdb: new upstream version 0.6.0
Package: cgdb Version: 0.5.3-2 Severity: wishlist The new version fixes several bugs and adds much improved tab completion. -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-686-smp Locale: [EMAIL PROTECTED], [EMAIL PROTECTED] (charmap=UTF-8) Versions of packages cgdb depends on: ii gdb 6.3-5 The GNU Debugger ii libc6 2.3.5-12 GNU C Library: Shared libraries an ii libncurses5 5.4-9 Shared libraries for terminal hand ii libreadline5 5.0-10 GNU readline and history libraries -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350896: knotes: crash on note deletion
Package: knotes Version: 4:3.5.0-5+b1 Severity: normal 1) remove ~/.kde/share/apps/knotes 2) start knotes 3) type something in the new note 4) right click on note title, select delete 4) crash (no debugging symbols found) Using host libthread_db library /lib/tls/libthread_db.so.1. (no debugging symbols found) ... (no debugging symbols found) [Thread debugging using libthread_db enabled] [New Thread -1237174592 (LWP 28730)] (no debugging symbols found) ... (no debugging symbols found) [KCrash handler] #5 0xb6eaf502 in QColor::QColor () from /usr/lib/libqt-mt.so.3 #6 0x0806cd7e in KNote::staticMetaObject () #7 0x08070ddc in KNote::staticMetaObject () #8 0xb6f08b52 in QObject::activate_filters () from /usr/lib/libqt-mt.so.3 #9 0xb6f08bdb in QObject::event () from /usr/lib/libqt-mt.so.3 #10 0xb6f46dcd in QWidget::event () from /usr/lib/libqt-mt.so.3 #11 0xb70907d7 in QTextEdit::event () from /usr/lib/libqt-mt.so.3 #12 0xb6ea1698 in QApplication::internalNotify () from /usr/lib/libqt-mt.so.3 #13 0xb6ea249d in QApplication::notify () from /usr/lib/libqt-mt.so.3 #14 0xb75a7fde in KApplication::notify () from /usr/lib/libkdecore.so.4 #15 0xb6e31653 in QApplication::sendSpontaneousEvent () from /usr/lib/libqt-mt.so.3 #16 0xb6ea458c in QApplication::setActiveWindow () from /usr/lib/libqt-mt.so.3 #17 0xb6e2b197 in QApplication::x11ProcessEvent () from /usr/lib/libqt-mt.so.3 #18 0xb6e448c0 in QEventLoop::processEvents () from /usr/lib/libqt-mt.so.3 #19 0xb6eb9da2 in QEventLoop::enterLoop () from /usr/lib/libqt-mt.so.3 #20 0xb6ea0255 in QApplication::enter_loop () from /usr/lib/libqt-mt.so.3 #21 0xb7b07ec0 in KIO::NetAccess::enter_loop () from /usr/lib/libkio.so.4 #22 0xb7b6cd74 in KIO::NetAccess::delInternal () from /usr/lib/libkio.so.4 #23 0xb7b81abc in KIO::NetAccess::del () from /usr/lib/libkio.so.4 #24 0x0806c8c4 in KNote::staticMetaObject () #25 0x08071944 in KNote::staticMetaObject () #26 0xb6f0bb57 in QObject::activate_signal () from /usr/lib/libqt-mt.so.3 #27 0xb6f0c63b in QObject::activate_signal () from /usr/lib/libqt-mt.so.3 #28 0xb698bcb9 in KAction::activated () from /usr/lib/libkdeui.so.4 #29 0xb69c5b11 in KAction::slotActivated () from /usr/lib/libkdeui.so.4 #30 0xb69e4b3e in KAction::slotPopupActivated () from /usr/lib/libkdeui.so.4 #31 0xb69e4e11 in KAction::qt_invoke () from /usr/lib/libkdeui.so.4 #32 0xb6f0bb57 in QObject::activate_signal () from /usr/lib/libqt-mt.so.3 #33 0xb729c055 in QSignal::signal () from /usr/lib/libqt-mt.so.3 #34 0xb6f29a40 in QSignal::activate () from /usr/lib/libqt-mt.so.3 #35 0xb70336c3 in QPopupMenu::mouseReleaseEvent () from /usr/lib/libqt-mt.so.3 #36 0xb6999091 in KPopupMenu::mouseReleaseEvent () from /usr/lib/libkdeui.so.4 #37 0xb6f46ec6 in QWidget::event () from /usr/lib/libqt-mt.so.3 #38 0xb6ea1698 in QApplication::internalNotify () from /usr/lib/libqt-mt.so.3 #39 0xb6ea1c6b in QApplication::notify () from /usr/lib/libqt-mt.so.3 #40 0xb75a7fde in KApplication::notify () from /usr/lib/libkdecore.so.4 #41 0xb6e31653 in QApplication::sendSpontaneousEvent () from /usr/lib/libqt-mt.so.3 #42 0xb6e2c878 in QETWidget::translateMouseEvent () from /usr/lib/libqt-mt.so.3 #43 0xb6e2adbe in QApplication::x11ProcessEvent () from /usr/lib/libqt-mt.so.3 #44 0xb6e448c0 in QEventLoop::processEvents () from /usr/lib/libqt-mt.so.3 #45 0xb6eb9da2 in QEventLoop::enterLoop () from /usr/lib/libqt-mt.so.3 #46 0xb6eb9ccb in QEventLoop::exec () from /usr/lib/libqt-mt.so.3 #47 0xb6ea0225 in QApplication::exec () from /usr/lib/libqt-mt.so.3 #48 0x08062730 in ?? () #49 0xbffdfd30 in ?? () #50 0xb7390321 in typeinfo name for QApplication () from /usr/lib/libqt-mt.so.3 #51 0xbffdfd30 in ?? () #52 0x08091538 in vtable for QGList () #53 0x in ?? () -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable'), (1, 'experimental') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.12-1-686 Locale: LANG=C, LC_CTYPE=C (charmap=ANSI_X3.4-1968) Versions of packages knotes depends on: ii kdelibs4c2a 4:3.5.1-1 core libraries for all KDE applica ii libc62.3.5-9 GNU C Library: Shared libraries an ii libgcc1 1:4.0.2-5 GCC support library ii libkcal2b4:3.5.0-5+b1KDE calendaring library ii libkdepim1a 4:3.5.0-5+b1KDE PIM library ii libqt3-mt3:3.3.5-3 Qt GUI Library (Threaded runtime v ii libstdc++6 4.0.2-5 The GNU Standard C++ Library v3 ii libx11-6 6.8.2.dfsg.1-11 X Window System protocol client li knotes recommends no packages. -- no debconf information -- Stefan Völkel mobile: +49.170.79177.17 Millenux GmbH phone: +49.711.88770.300 Lilienthalstraße 2 phone: +49.89.608665.27 70825 Stuttgart-Korntal fax: +49.711.88770.349
Bug#350797: openjade: Fails on entity definitions in xml-iso-entities-*
On Feb 1, Frans Pop ([EMAIL PROTECTED]) wrote: severity 350797 minor thanks Thanks for your quick reaction. On Wednesday 01 February 2006 04:26, you wrote: The problem is that in order to resolve a long standing performance problem, I turned off DTDDECL handling in the the libosp5 package on which openjade depends. What this means is that you need to explicitly specify the XML declaration before the document: /usr/bin/openjade -t tex -b utf-8 -o build.tmp/install.en.tex \ -d /home/fjp/projects/manual-build/manual/build/stylesheets/style-print.dsl \ -V tex-backend declaration/xml.dcl build.tmp/install.en.profiled.xml ^^^ This works for me. Great. This is a reversion back to an older (pre-Sarge) form of the command. I think this is a small price to pay for the huge performance gain (a factor of 10-20), but let me know if it is not an option for you; if so, I'll consider reinstating the behavior as it was in Sarge. Please consider documenting this change in NEWS.Debian with your next upload. Leaving the report open for that. Good idea, will do. The performance gain is indeed impressive. Here are some results for the Installation Guide: $ time ./buildone.sh i386 en pdf Info: creating temporary profiled .xml file... Info: creating temporary .tex file... Info: creating temporary .dvi file... Info: creating .pdf file... real0m45.286s user0m43.041s sys 0m2.427s upgrade to new openjade $ time ./buildone.sh i386 en pdf Info: creating temporary profiled .xml file... Info: creating temporary .tex file... Info: creating temporary .dvi file... Info: creating .pdf file... real0m24.491s user0m24.252s sys 0m0.451s That's only a factor of two, not 10-20 that I've seen; I'm glad you think that is impressive! :-) -- Neil Roeth -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#348971: qa.debian.org: please consider converting PTS to a CSS layout
On 01/02/06 at 09:43 +0100, Marc Haber wrote: On Wed, Feb 01, 2006 at 09:39:54AM +0100, Florian Weimer wrote: * Marc Haber: I want to check whether a given package has migrated from unstable to testing in a cron job, and this cron job should be able to run on a host that doesn't have a local archive. With the arrivale of Packages diffs, it's actually rather cheap (in terms of network bandwidth) to maintain a local mirror of the archive metadata. AFAICS, you only need the Sources files, so the disk space consumption shouldn't be an obstacle, either. Having never really understood the rather sparsely documented apt.conf syntax, I am reluctant to use apt to keep metadata current on a system without root privileges. Additionally, parsing the Sources file is another challenge. And again additionally, I don't want to get alerts just because my mirror is down or desynced. Have a look at MultiDistroTools[0]. I use a custom apt config to be able to run apt-get update as normal user for different distributions. It should be easy to adapt it to do what you want. [0] https://wiki.ubuntu.com/MultiDistroTools -- | Lucas Nussbaum | [EMAIL PROTECTED] http://www.lucas-nussbaum.net/ | | jabber: [EMAIL PROTECTED] GPG: 1024D/023B3F4F | -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#263052: Ask the OpenOffice folks...
[ CC'ing -openoffice ] Am Mittwoch 01 Februar 2006 07:23 schrieb Nathanael Nerode: They are the only reason this package *exists*. Not really. stlport4.5 existed in Debian even before OOo was uploaded. OOo itself uses an old stlport 4.5 in it's source still and we (Debian) switched to 4.6. I don't think that counts as the only reason tis package exists since it existed in the archive before already. In any case, this package is cdbs. As there's no sane way to to use cdbs here I won't co-maintain it (not to mention I don't really have time but that's another story) unless normal debhelper is used and bugs like http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=292575 and http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=173395 (if it's worthwile to fix it - can the stlport lib just be compiled with -g and we use dh_strip --dbg-package) can be easier fixed than with cdbs... Regards, Rene P.S.: s/OpenOffice/OpenOffice.org/ ... -- .''`. René Engelhard -- Debian GNU/Linux Developer : :' : http://www.debian.org | http://people.debian.org/~rene/ `. `' [EMAIL PROTECTED] | GnuPG-Key ID: 248AEB73 `- Fingerprint: 41FA F208 28D4 7CA5 19BB 7AD9 F859 90B0 248A EB73
Bug#346085: Patch as applied in NMU
Here's the full patch that I applied. This includes an update of debhelper
compatibility.
Cheers,
FJP
diff -u afbinit-1.0/debian/changelog afbinit-1.0/debian/changelog
--- afbinit-1.0/debian/changelog
+++ afbinit-1.0/debian/changelog
@@ -1,3 +1,12 @@
+afbinit (1.0-1.1) unstable; urgency=low
+
+ * Non Maintainer Upload.
+ * Change the mmap() of the card's registers to use MAP_SHARED instead
+of MAP_PRIVATE. Closes: #346085.
+ * Update debhelper compatibitily to version 5.
+
+ -- Frans Pop [EMAIL PROTECTED] Wed, 1 Feb 2006 14:20:57 +0100
+
afbinit (1.0-1) unstable; urgency=low
* Initial Release.
diff -u afbinit-1.0/debian/rules afbinit-1.0/debian/rules
--- afbinit-1.0/debian/rules
+++ afbinit-1.0/debian/rules
@@ -1,7 +1,5 @@
#!/usr/bin/make -f
-export DH_COMPAT=3
-
build: build-stamp
build-stamp:
dh_testdir
diff -u afbinit-1.0/debian/control afbinit-1.0/debian/control
--- afbinit-1.0/debian/control
+++ afbinit-1.0/debian/control
@@ -2,7 +2,7 @@
Section: contrib/utils
Priority: optional
Maintainer: Ben Collins [EMAIL PROTECTED]
-Build-Depends: debhelper ( 3.0.0)
+Build-Depends: debhelper (= 5.0.0)
Standards-Version: 3.5.2
Package: afbinit
only in patch2:
unchanged:
--- afbinit-1.0.orig/afbinit.c
+++ afbinit-1.0/afbinit.c
@@ -236,7 +236,7 @@
/* MMAP the registers. */
uregs = mmap(0, 0x2000,
PROT_READ | PROT_WRITE,
- MAP_PRIVATE,
+ MAP_SHARED,
afb_fd,
0x0400);
if (uregs == (void *)-1L) {
@@ -246,7 +246,7 @@
kregs = mmap(0, 0x2000,
PROT_READ | PROT_WRITE,
- MAP_PRIVATE,
+ MAP_SHARED,
afb_fd,
0x0bc04000);
if (kregs == (void *)-1L) {
only in patch2:
unchanged:
--- afbinit-1.0.orig/debian/compat
+++ afbinit-1.0/debian/compat
@@ -0,0 +1 @@
+5
pgp8M588546tu.pgp
Description: PGP signature
Bug#350898: background the control socket connection
Package: ssh Version: 1:4.2p1-5 Severity: wishlist if I use control sockets and exit the first connection, the ssh process does not return until all other connections using the same control socket have been closed. of course, this makes sense. I wish that the master connection would either background itself when the user chooses to close the connection, or better yet: the first connection to any peer, which thus creates a control socket, should background the ssh process handling the control socket and spawn another ssh process that then uses the control socket. am i making any sense? if my suggestion is implemented, the following should not happen: lapse:~ (ssh dorian sleep 4 echo master returned: `date`) ; sleep 2; (ssh dorian sleep 4 echo second returned: `date`); read second returned: Wed Feb 1 14:39:03 CET 2006 master returned: Wed Feb 1 14:39:03 CET 2006 instead, the second should return 2 seconds after the master. -- System Information: Debian Release: testing/unstable APT prefers stable APT policy: (700, 'stable'), (600, 'testing'), (98, 'unstable'), (1, 'experimental') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-686 Locale: LANG=en_GB, LC_CTYPE=en_GB.UTF-8 (charmap=UTF-8) Versions of packages ssh depends on: ii openssh-client1:4.2p1-5 Secure shell client, an rlogin/rsh ii openssh-server1:4.2p1-5 Secure shell server, an rshd repla ssh recommends no packages. -- debconf-show failed -- .''`. martin f. krafft [EMAIL PROTECTED] : :' :proud Debian developer and author: http://debiansystem.info `. `'` `- Debian - when you have better things to do than fixing a system Invalid/expired PGP (sub)keys? Use subkeys.pgp.net as keyserver! fashions have done more harm than revolutions. -- victor hugo signature.asc Description: Digital signature (GPG/PGP)
Bug#350859: liquidwar: please update for allegro 4.2
On Wed, February 1, 2006 6:46 am, Laurent Bonnaud said: Package: liquidwar Version: 5.6.2-2 Severity: wishlist Hi, could you please update liquidwar to depend on liballegro4.2 instead of liballegro4.1 ? Err, well, carefull, liquidwar-5.6.2 - allegro-4.1.x but liquidwar-5.6.3 - allegro-4.2.x AFAIK there are slight changes in Allegro's API between 4.1 and 4.2 which partly justified the release of LW 5.6.3 (along with bug-fixes of course). So fixing LW so that it depends on Allegro 4.2 might require more than changing the dependency, switching to 5.6.3 is likely to be the right option. Have a nice day, Christian. -- Christian Mauduit [EMAIL PROTECTED] __/\__ ___ \~/ ~/(`_ \ ___ http://www.ufoot.org/ /_o _\ \ \_/ _ \_ http://www.ufoot.org/gnupg.pub\/ \___/ \__)
Bug#338376: [debiandoc-sgml-pkgs] Bug#338376: \usepackage[force]{textcomp} side effects for debiandoc-sgml
On Tue, Jan 31, 2006 at 08:44:25PM +0100, Frank Küster wrote: Jens Seidel [EMAIL PROTECTED] wrote: debiandoc-sgml does no longer build Debian FAQ. $ latex /tmp/error.tex This is e-TeX, Version 3.14159-2.1 (Web2C 7.4.5) entering extended mode This is not the version in unstable, but in testing or sarge. Hm. Bad if that has the effect that debiandoc-sgml cannot be backported to sarge withouth changes. Is this really a problem - there are also other alternatives, although less elegant. I think it is better to make debiandoc-sgml compatible with tetex 2.0 and 3.0. If anyone propose good fix, I will use it as the next update. Osamu
Bug#350899: kdebase-dev won't install without removing GNOME packages.
Package: kdebase-dev Version: Package confilicts with a number of GNOME packages including gamin... Severity: important When attemtping apt-get install kdebase-dev you are warned that a number of GNOME packages will be removed (including but not limited to) gamin, gnome-screensaver and mail-notification. The gamain package seems rather important. I don't knos if it's part of the base install of GNOME so I'm afraid to proceed with the installation of kdebase-dev (which is needed in order to complie KDE themes from source). -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable'), (500, 'testing'), (1, 'experimental') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.15-1-686 Locale: LANG=en_US.UTF-8, LC_CTYPE=en_US.UTF-8 (charmap=UTF-8) -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350535: bugs from Samba package after an update
On Mon, Jan 30, 2006 at 09:47:38AM +0100, dominique laurent vhcs wrote: Hi, sound to be a bug in Samba for Debian, following an apt-get upgrade today. After upgrading the system, shares are not accessible by windows XP Pro. Please send us your smb.conf file as well. There seems to be at least one bug in it, since according to the logs, nmbd isn't finding any interfaces. -- Steve Langasek Give me a lever long enough and a Free OS Debian Developer to set it on, and I can move the world. [EMAIL PROTECTED] http://www.debian.org/ signature.asc Description: Digital signature
Bug#350900: /etc/default/wpasupplicant: significant typo: CONFIGFILE vs. CONFIG_FILE
Package: wpasupplicant
Version: 0.4.7-2
Severity: normal
Tags: patch
Hi!
In the /etc/default/wpasupplicant file, there is
CONFIGFILE=/etc/wpa_supplicant.conf
and
OPTIONS=-w -i ${INTERFACE} -D ${DRIVER} -c ${CONFIG_FILE}
Since ${CONFIG_FILE} (note additional underscore) is empty this
creates an error message, when trying to start wpasupplicant.
Please change one of the two variable names so that they are equal.
Thanks for your time and work!
Regards, David
-- System Information:
Debian Release: testing/unstable
APT prefers unstable
APT policy: (500, 'unstable')
Architecture: i386 (i686)
Shell: /bin/sh linked to /bin/bash
Kernel: Linux 2.6.15-3+suspend2.2-p4-1
Locale: LANG=C, LC_CTYPE=de_AT.UTF-8 (charmap=UTF-8)
Versions of packages wpasupplicant depends on:
ii libc6 2.3.5-12 GNU C Library: Shared libraries an
ii libncurses5 5.5-1 Shared libraries for terminal hand
ii libreadline5 5.1-5 GNU readline and history libraries
ii libssl0.9.8 0.9.8a-6 SSL shared libraries
wpasupplicant recommends no packages.
-- no debconf information
--
To UNSUBSCRIBE, email to [EMAIL PROTECTED]
with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350813: installation-reports
On Tue, Jan 31, 2006 at 06:02:30PM -0500, Doug Tutty wrote: I have had poor luck with the 3.1 installer. Is there any disadvantage to using the 3.0 installer with minimal base system and upgrading via ppp? No there is no problem with that. In fact for very old machines it may be easier if the new installer needs too much ram. I have one machine that started with an install of 2.0 and has upgraded ever since. Given your machine has 32M ram, that could be causing some issues. I think in a few cases the current installer might not work in 32M. Older ones certainly did. If you do the base install with 3.0 and then just upgrade it should be fine on that machine. I have a 486/66 wiht 48M ram that runs sarge perfectly, but I have never tried the sarge installer on that machine. It last had an install from scratch in I think 1998. Len Sorensen -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350901: crash on File - Open after or while playing a file
Package: totem-xine Version: 1.2.1-3 Playing a movie and then doing File - Open results in a crash. Here's a backtrace. Program received signal SIGSEGV, Segmentation fault. [Switching to Thread 805521088 (LWP 3160)] 0x0eabb54c in g_object_ref () from /usr/lib/libgobject-2.0.so.0 (gdb) bt #0 0x0eabb54c in g_object_ref () from /usr/lib/libgobject-2.0.so.0 #1 0x0f7cec34 in _gtk_file_chooser_default_get_type () from /usr/lib/libgtk-x11-2.0.so.0 #2 0x0f7bfdd4 in gtk_file_chooser_add_filter () from /usr/lib/libgtk-x11-2.0.so.0 #3 0x0f7bfdd4 in gtk_file_chooser_add_filter () from /usr/lib/libgtk-x11-2.0.so.0 #4 0x0f7bfdd4 in gtk_file_chooser_add_filter () from /usr/lib/libgtk-x11-2.0.so.0 #5 0x10029824 in totem_add_files () #6 0x10019610 in totem_action_open_dialog () #7 0x100196e8 in totem_action_open_dialog () #8 0x0eac7f14 in g_cclosure_marshal_VOID__VOID () from /usr/lib/libgobject-2.0.so.0 #9 0x0eab82b0 in g_closure_invoke () from /usr/lib/libgobject-2.0.so.0 #10 0x0eacc2e8 in g_signal_stop_emission () from /usr/lib/libgobject-2.0.so.0 #11 0x0eacd558 in g_signal_emit_valist () from /usr/lib/libgobject-2.0.so.0 #12 0x0eacd99c in g_signal_emit () from /usr/lib/libgobject-2.0.so.0 #13 0x0f959bf8 in gtk_widget_activate () from /usr/lib/libgtk-x11-2.0.so.0 #14 0x0f84c3e8 in gtk_menu_shell_activate_item () from /usr/lib/libgtk-x11-2.0.so.0 #15 0x0f84c7d8 in gtk_menu_shell_activate_item () from /usr/lib/libgtk-x11-2.0.so.0 #16 0x0f83fcac in gtk_menu_reorder_child () from /usr/lib/libgtk-x11-2.0.so.0 #17 0x0f8386dc in _gtk_marshal_BOOLEAN__BOXED () from /usr/lib/libgtk-x11-2.0.so.0 #18 0x0eab79cc in g_cclosure_new_swap () from /usr/lib/libgobject-2.0.so.0 #19 0x0eab82b0 in g_closure_invoke () from /usr/lib/libgobject-2.0.so.0 #20 0x0eacbef8 in g_signal_stop_emission () from /usr/lib/libgobject-2.0.so.0 #21 0x0eacd274 in g_signal_emit_valist () from /usr/lib/libgobject-2.0.so.0 #22 0x0eacd99c in g_signal_emit () from /usr/lib/libgobject-2.0.so.0 #23 0x0f959e84 in gtk_widget_activate () from /usr/lib/libgtk-x11-2.0.so.0 #24 0x0f836478 in gtk_propagate_event () from /usr/lib/libgtk-x11-2.0.so.0 #25 0x0f8369f8 in gtk_main_do_event () from /usr/lib/libgtk-x11-2.0.so.0 #26 0x0f64c80c in _gdk_events_queue () from /usr/lib/libgdk-x11-2.0.so.0 #27 0x0e850bb4 in g_main_context_dispatch () from /usr/lib/libglib-2.0.so.0 #28 0x0e854e6c in g_main_context_check () from /usr/lib/libglib-2.0.so.0 #29 0x0e8552c4 in g_main_loop_run () from /usr/lib/libglib-2.0.so.0 #30 0x0f8357d8 in gtk_main () from /usr/lib/libgtk-x11-2.0.so.0 #31 0x1001cbe8 in main () -- System Information: Debian Release: unstable APT prefers unstable APT policy: (500, 'unstable'), (499, 'experimental') Architecture: powerpc (ppc) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.6.14.3 Locale: LANG=C, LC_CTYPE=C (charmap=ANSI_X3.4-1968) Versions of packages totem-xine depends on: ii gconf2 2.12.1-8 GNOME configuration database syste ii libart-2.0-2 2.3.17-1 Library of functions for 2D graphi ii libatk1.0-01.10.3-1 The ATK accessibility toolkit ii libaudiofile0 0.2.6-6 Open-source version of SGI's audio ii libbonobo2-0 2.10.1-1 Bonobo CORBA interfaces library ii libbonoboui2-0 2.10.1-2 The Bonobo UI library ii libc6 2.3.5-12 GNU C Library: Shared libraries an ii libcairo2 1.0.2-3 The Cairo 2D vector graphics libra ii libdbus-1-20.60-5simple interprocess messaging syst ii libdbus-glib-1-2 0.60-5simple interprocess messaging syst ii libesd00.2.36-3 Enlightened Sound Daemon - Shared ii libexpat1 1.95.8-3 XML parsing C library - runtime li ii libfontconfig1 2.3.2-1.1 generic font configuration library ii libfreetype6 2.1.10-1 FreeType 2 font engine, shared lib ii libgconf2-42.12.1-8 GNOME configuration database syste ii libgcrypt111.2.2-1 LGPL Crypto library - runtime libr ii libglade2-01:2.5.1-2 library to load .glade files at ru ii libglib2.0-0 2.8.6-1 The GLib library of C routines ii libgnome-desktop-2 2.12.2-2 Utility library for loading .deskt ii libgnome-keyring0 0.4.6-2 GNOME keyring services library ii libgnome2-02.12.0.1-4The GNOME 2 library - runtime file ii libgnomecanvas2-0 2.12.0-2 A powerful object-oriented display ii libgnomeui-0 2.12.0-2 The GNOME 2 libraries (User Interf ii libgnomevfs2-0 2.12.2-5 GNOME virtual file-system (runtime ii libgnutls111.0.16-14 GNU TLS library - runtime library ii libgpg-error0
Bug#347672: evolution: Evolution 2.4.2.1 freezes on startup
-BEGIN PGP SIGNED MESSAGE- Hash: SHA1 Loïc Minier ha scritto: Could you please try to killall evolution-data-server-1.4? sadly, I had to stop using Evolution :( I messed up with configuration files, and I found that there's nothing (or, at least, I think so) wrong in .evolution, the issue is in gconfd when brutally killed/crashed. It seems that gconfd leaves some dirty behind it, and it causes Evolution to freeze. I survived the first 3-4 waves, last time I got to delete all evolution's gconfd settings, and I lost all my account configuration and all. I have also to tell that I'm not using Gnome as my DM, but I'm using Enlightenment DR17 (cvs) with gnome-settings-daemon running under it. Maybe it can help. - -- Ciro Mattia Gonano Winged.it Master - http://www.winged.it FlyingCircus.it member - http://www.flyingcircus.it GPG Keynumber: DEF86925 --- ICQ#: 52631406 -BEGIN PGP SIGNATURE- Version: GnuPG v1.4.2 (GNU/Linux) Comment: Using GnuPG with Mozilla - http://enigmail.mozdev.org iD8DBQFD3/03cioIad74aSURAoZEAJ9HbBFvegpQSfV4gZ0FLFeNIk9UZwCghww5 6mZrgdoVgIMk2/OfowDHg8s= =Y/7V -END PGP SIGNATURE-
Bug#350467: gri 2.12.10-4 still won't compile...
reopen 350467 thanks Hi Dan, Sorry for asll the hassle... I'll try to find a developer computer to test build the next round. :-( if g++ -DDEFAULT_GRI_DIR=\/usr/share/gri/2.12.10/\ -DPACKAGE_NAME=\gri\ -DPACKAGE_TARNAME=\gri\ -DPACKAGE_VERSION=\2.12.10\ -DPACKAGE_STRING=\gri\ 2.12.10\ -DPACKAGE_BUGREPORT=\\ -DPACKAGE=\gri\ -DVERSION=\2.12.10\ -DGRI_IS_BIG_ENDIAN=0 -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_UNISTD_H=1 -DHAVE_LIBNETCDF=1 -DSTDC_HEADERS=1 -DHAVE_ISNAN=1 -DHAVE_ISINF=1 -DHAVE_ACOSH=1 -DHAVE_GETCWD=1 -DHAVE_POPEN=1 -DHAVE_MKSTEMP=1 -DHAVE_TMPNAM=1 -DHAVE_TEMPNAM=1 -DHAVE_GETHOSTNAME=1 -DHAVE_ACCESS=1 -DHAVE_LSTAT=1 -DHAVE_STAT=1 -DHAVE_STRERROR=1 -DHAVE_GETENV=1 -DHAVE_DRAND48=1 -I. -I. -Wall -DCPLUSPLUSNEW -fno-strength-reduce -I/usr/include -O2 -MT GriColor.o -MD -MP -MF .deps/GriColor.Tpo -c -o GriColor.o GriColor.cc; \ then mv -f .deps/GriColor.Tpo .deps/GriColor.Po; else rm -f .deps/GriColor.Tpo; exit 1; fi CmdFile.hh: In member function 'void CmdFile::set(const char*, FILE*, bool, int, bool)': CmdFile.hh:54: error: cast from 'CmdFile*' to 'int' loses precision DataFile.hh: In constructor 'DataFile::DataFile()': DataFile.hh:21: error: cast from 'FILE*' to 'unsigned int' loses precision DataFile.hh:23: error: cast from '_IO_FILE*' to 'unsigned int' loses precision make[2]: *** [GriColor.o] Error 1 -- Peter -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350694: velocity: FTBFS: -Dbuild.compiler=jikes without Build-Depends on jikes
-BEGIN PGP SIGNED MESSAGE- Hash: SHA1 Wolfgang Baer wrote: The package is ready for upload since some time. However my sponsor is currently quite busy. Will be resolved soon. I'm back! :-D - -- .''`. : :' :rnaud `. `' `- Java Trap: http://www.gnu.org/philosophy/java-trap.html -BEGIN PGP SIGNATURE- Version: GnuPG v1.4.1 (GNU/Linux) Comment: Using GnuPG with Thunderbird - http://enigmail.mozdev.org iD8DBQFD4MTv4vzFZu62tMIRAonsAKCrWF0VyOQUtixayu9CM+2zGpLE+QCguMUv urGHC1nbGyetStXVoz+FWkQ= =9DLk -END PGP SIGNATURE- -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350142: Debian will not provide comprehensive config files at this time
severity 350142 wishlist tag 350142 wontfix thanks You are correct, users are supposed to read the documentation, and modify/add the settings they need. Debian will not be doing anything more than maintaining a good, fail-safe and sane default configuration for amavisd-new. Bugs on that configuration (e.g. lack of local_domains) will be fixed of course (see #348990). I will tagging this bug wontfix for now. BTW, max_servers' correct setting depends not just on machine power. It depends on the set of network-based tests your amavisd-new do. For AV mode, then yes, it is only CPU- and disk-bound. But enable SA with non-local tests, and you will see huge ammounts of time sleeping while waiting for DNS queries. The fact that AV and SA are disabled by default is well documented in the newer packages in various places, including 15-content_filter_mode. We will not touch 50-user. local_domain* issues were fixed (#348990) already. mynetworks, recipient_delimiter and the *quarantine* stuff are not relevant to Debian's default configuration. -- One disk to rule them all, One disk to find them. One disk to bring them all and in the darkness grind them. In the Land of Redmond where the shadows lie. -- The Silicon Valley Tarot Henrique Holschuh -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#338376: [debiandoc-sgml-pkgs] Bug#338376: \usepackage[force]{textcomp} side effects for debiandoc-sgml
Osamu Aoki [EMAIL PROTECTED] wrote: On Tue, Jan 31, 2006 at 08:44:25PM +0100, Frank Küster wrote: Jens Seidel [EMAIL PROTECTED] wrote: debiandoc-sgml does no longer build Debian FAQ. $ latex /tmp/error.tex This is e-TeX, Version 3.14159-2.1 (Web2C 7.4.5) entering extended mode This is not the version in unstable, but in testing or sarge. Hm. Bad if that has the effect that debiandoc-sgml cannot be backported to sarge withouth changes. Is this really a problem - there are also other alternatives, although less elegant. I think it is better to make debiandoc-sgml compatible with tetex 2.0 and 3.0. If anyone propose good fix, I will use it as the next update. The alternative is to drop [force] and use \currency instead of \textcurrency. This will use the currency symbol from the wasy fonts (wasysym.sty is already loaded, anyway) instead of trying Palatino's currency symbol. It doesn't fit smoothly into a text typeset in Palatino, but I don't think this is a severe problem: First of all, this symbol is only rarely used in continous text and will stand out anyway. Second, the Palatino currency symbol looks ugly in my opinion - one can hardly see that it's not just a circle, whereas the wasysym one is nicer. Is that sufficient information, or do you need more assistance in changing the generated LaTeX file? Regards, Frank -- Frank Küster Single Molecule Spectroscopy, Protein Folding @ Inst. f. Biochemie, Univ. Zürich Debian Developer (teTeX)
Bug#350903: cmr10 not loadable
Package: texinfo
Version: 4.8-4
Severity: serious
When I try to build AutoGen on Alpha, it fails as follows:
TEXINPUTS=../config:$TEXINPUTS \
MAKEINFO='/bin/sh
/src/sid/home/kraai/autogen-5.8.1/config/missing --run
makeinfo -I../autoopts -I../autoopts -I .' \
texi2dvi autogen.texi
This is pdfeTeX, Version 3.141592-1.21a-2.2 (Web2C 7.5.4)
entering extended mode
(./txiversion.tex (/usr/share/texmf/tex/texinfo/texinfo.tex
Loading texinfo [version 2004-11-25.16]: Basics, pdf, fonts,
! Font \textrm=cmr10 scaled 1095 not loadable: Metric (TFM) file not
found.
\mainmagstep -1095
l.1474 \setfont\textrm\rmshape{10}{\mainmagstep}
?
! Emergency stop.
\mainmagstep -1095
l.1474 \setfont\textrm\rmshape{10}{\mainmagstep}
No pages of output.
Transcript written on txiversion.log.
kpathsea: Running mktextfm cmr10
/usr/share/texmf/web2c/mktexnam: Could not map source abbreviation
for cmr10.
/usr/share/texmf/web2c/mktexnam: Need to update ?
mktextfm: Running mf-nowin -progname=mf \mode:=ljfour; mag:=1;
nonstopmode; input cmr10
This is METAFONT, Version 2.71828 (Web2C 7.5.4)
kpathsea: Running mktexmf cmr10
! I can't find file `cmr10'.
* ...e:=ljfour; mag:=1; nonstopmode; input cmr10
Please type another input file name
! Emergency stop.
* ...e:=ljfour; mag:=1; nonstopmode; input cmr10
Transcript written on mfput.log.
grep: cmr10.log: No such file or directory
mktextfm: `mf-nowin -progname=mf \mode:=ljfour; mag:=1; nonstopmode;
input cmr10' failed to make cmr10.tfm.
kpathsea: Appending font creation commands to missfont.log.
/usr/bin/texi2dvi: texinfo.tex appears to be broken, quitting.
make[1]: *** [autogen.dvi] Error 1
make[1]: Leaving directory `/home/kraai/autogen-5.8.1/doc'
make: *** [build-stamp] Error 2
I was able to find the cmr10.tfm file:
$ find /usr -name cmr10\*
/usr/share/texmf-tetex/fonts/tfm/public/cm/cmr10.tfm
/usr/share/texmf-tetex/fonts/source/public/cm/cmr10.mf
This is serious because it prevents the autogen package from building.
--
Matt
signature.asc
Description: Digital signature
Bug#350902: [intl:fr] libapache-sessionx-perl debconf template translation
Package: libapache-sessionx-perl Version: 2.00b5-3 Severity: wishlist Tags: l10n Patch Hi, Please find attached the french debconf templates translation, proofread by the debian-l10n-french mailing list contributors. This file should be put as debian/po/fr.po in your package build tree. Regards -- steve jabber : [EMAIL PROTECTED] fr.po Description: application/gettext
Bug#350904: xnc always crashes with segfault when trying to start
Package: xnc Version: 5.0.4-2.1 Severity: grave Justification: renders package unusable Just after installing xnc, I tried to start it and I got : Loading resourcesOK **Image Engine** * * *Visual: TrueColor* *Depth: 16 (2 bytes/pixel) * *RGB: 5:6:5* *Colors: 65536* *Images: GIF,JPEG,PCX * * * (c) Leo 96-98 * Connecting to IVE System.failed (make it later) Compiling Key Support..OK (0) warnings, (0) errors Total actions defined: 65 Compiling AFS supports: ZIP TAR GZIP BZIP2 TARBZ2 TARGZ RPM DEB UNARJ RAR LHA (0) warnings, (0) errors Error: Can't open support '/root/.xnc/xnc.ftp' *** OOPS! Il semblerait que vous ayez découvert un bug dans XNC!!! Si vous pouvez reproduire cette situation envoyez un rapport de bug à [EMAIL PROTECTED] avec en objet 'XNC - bug report' Dans le corps du message : - ce que vous faites pour obtenir le bug. - la configuration de XNC configuration (~/.xnc/xnc.ini) file ; - résultat de la commande 'ldd xnc' ; - configuration du serveur X (résolution et nombre de couleurs) ; - votre adresse mail, pour retour d'information éventuel si nécessaire. N'incluez PAS le fichier 'CORE' dump dans le message. Merci, et désolé pour ce bug. *** Erreur de segmentation this is my ~/.xnc/xnc.ini file : #This is initialisation file for X Northern Captain... #COLORS leoprogs.background: black leoprogs.foreground: white leoprogs.keys.background: #b7b0ae northgui.color.background: #d4d2de northgui.color.shadow: #515250 northgui.color.text: #00 northgui.color.text_warn: #ff northgui.color.text2: #33 northgui.color.cursor: #bbb4f0 xnc.panel_color.info: #00 xnc.panel_color.selected_file: #00 xnc.panel_color.extension_file: #769ab5 xnc.panel_color.normal_file: #00 xnc.panel_color.directory_file: #1312f8 xnc.panel_color.execution_file: #00ae3e xnc.panel_color.link_file: #00a799 xnc.panel_color.afs_file: #fb5056 xnc.panel_color.image_file: #ff #FONTS leoprogs.font: -*-helvetica-medium-r-*-*-12-*-*-*-*-*-*-* leoprogs.list.font: -*-helvetica-*-r-*-*-14-*-*-*-*-*-*-* leoprogs.font.fixed: 8x13 leoprogs.viewer.font: 9x15 leoprogs.font.minifixed: 6x10 #COMMON xnc.sysfiles.path: auto xnc.editor.name: internal xnc.viewer.name: internal xnc.geometry: 750x700+10+5 xnc.viewer.geometry: 750x550+10+5 xnc.panels.layout: vertical xnc.bookmark.show_and_use: yes xnc.afs.update: prompt leoprogs.focus.return: no #File generated by X Northern Captain Setup. this is the result of the command ldd /usr/bin/xnc libpng12.so.0 = /usr/lib/libpng12.so.0 (0x40022000) libz.so.1 = /usr/lib/libz.so.1 (0x40048000) libtiff.so.4 = /usr/lib/libtiff.so.4 (0x4005c000) libSM.so.6 = /usr/X11R6/lib/libSM.so.6 (0x400b) libICE.so.6 = /usr/X11R6/lib/libICE.so.6 (0x400b9000) libX11.so.6 = /usr/X11R6/lib/libX11.so.6 (0x400d1000) libXext.so.6 = /usr/X11R6/lib/libXext.so.6 (0x4019c000) libdl.so.2 = /lib/libdl.so.2 (0x401ab000) libjpeg.so.62 = /usr/lib/libjpeg.so.62 (0x401af000) libstdc++.so.6 = /usr/lib/libstdc++.so.6 (0x401cf000) libm.so.6 = /lib/libm.so.6 (0x402ac000) libgcc_s.so.1 = /lib/libgcc_s.so.1 (0x402d2000) libc.so.6 = /lib/libc.so.6 (0x402dd000) /lib/ld-linux.so.2 (0x4000) -- System Information: Debian Release: testing/unstable APT prefers unstable APT policy: (500, 'unstable'), (500, 'testing'), (500, 'stable') Architecture: i386 (i686) Shell: /bin/sh linked to /bin/bash Kernel: Linux 2.4.20 Locale: [EMAIL PROTECTED], [EMAIL PROTECTED] (charmap=ISO-8859-15) Versions of packages xnc depends on: ii libc6 2.3.5-12 GNU C Library: Shared libraries an ii libgcc1 1:4.0.2-8 GCC support library ii libice6 6.9.0.dfsg.1-4 Inter-Client Exchange library ii libjpeg62 6b-11 The Independent JPEG Group's JPEG ii libpng12-01.2.8rel-5 PNG library - runtime ii libsm66.9.0.dfsg.1-4 X Window System Session Management ii libstdc++64.0.2-8The GNU Standard C++ Library v3 ii libtiff4 3.8.0-1Tag Image File Format
Bug#350905: asterisk: Multiple serious bugs in version currently in testing/unstable
Package: asterisk Version: 1:1.2.1.dfsg-3 Severity: grave Justification: renders package unusable Since 1.2.1 was released, the Asterisk folks have released new versions that fix multiple serious problems. Among the problems fixed: * 1.2.4 fixes a significant memory leak * 1.2.4 also fixes various SIP registration bugs * 1.2.3 fixes the grave timebomb bug. See http://bugs.digium.com/view.php?id=6349 * 1.2.3 also fixed some memory leaks * 1.2.3 fixed a bug with SIPAddHeader * 1.2.3 fixed a segfault * 1.2.2 also fixed a segfault * 1.2.2 also fixes a memory leak * 1.2.2 fixes a race condition surrounding uniqueid -- System Information: Debian Release: 3.1 Architecture: i386 (i686) Kernel: Linux 2.6.15.2 Locale: LANG=en_US, LC_CTYPE=en_US (charmap=ISO-8859-1) Versions of packages asterisk depends on: ii adduser3.63 Add and remove users and groups ii asterisk-config1:1.2.1.dfsg-3config files for asterisk ii asterisk-sounds-main 1:1.2.1.dfsg-3sound files for asterisk ii libasound2 1.0.8-3 ALSA library ii libc6 2.3.2.ds1-22 GNU C Library: Shared libraries an ii libcurl3 7.13.2-2sarge4Multi-protocol file transfer libra ii libgsm11.0.10-13 Shared libraries for GSM speech co ii libidn11 0.5.13-1.0GNU libidn library, implementation ii libncurses55.4-4 Shared libraries for terminal hand ii libnewt0.510.51.6-20 Not Erik's Windowing Toolkit - tex ii libpq3 7.4.7-6sarge1 PostgreSQL C client library ii libpri11.2.1-2 Primary Rate ISDN specification li ii libspeex1 1.1.6-2 The Speex Speech Codec ii libssl0.9.70.9.7e-3sarge1SSL shared libraries ii unixodbc 2.2.4-11 ODBC tools libraries ii zlib1g 1:1.2.2-4.sarge.2 compression library - runtime -- no debconf information -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#317290: Dependency missing again
found 317290 2.1.0-3 thanks Twisted 2.1.0 has python-soappy dependency missing again. Seo Sanghyeon -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#340393: Close?
Twisted package is now split, and python-twisted-mail package description now says: Twisted Mail contains high-level, efficient protocol implementations for both clients and servers of SMTP, POP3, and IMAP4. (snip) So apt-cache search mail does find it. Close this now? Seo Sanghyeon -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350905: asterisk: Multiple serious bugs in version currently in testing/unstable
On Wed, Feb 01, 2006 at 08:58:18AM -0600, John Goerzen wrote: Package: asterisk Version: 1:1.2.1.dfsg-3 Severity: grave Justification: renders package unusable Since 1.2.1 was released, the Asterisk folks have released new versions that fix multiple serious problems. Among the problems fixed: * 1.2.4 fixes a significant memory leak * 1.2.4 also fixes various SIP registration bugs * 1.2.3 fixes the grave timebomb bug. See http://bugs.digium.com/view.php?id=6349 Which was introduced in 1.2.2 and thus does not affect the current SID debs. That is not to say that those bugs are not important to fix. No need to file further bug reports on that... * 1.2.3 also fixed some memory leaks * 1.2.3 fixed a bug with SIPAddHeader * 1.2.3 fixed a segfault * 1.2.2 also fixed a segfault * 1.2.2 also fixes a memory leak * 1.2.2 fixes a race condition surrounding uniqueid -- System Information: Debian Release: 3.1 Architecture: i386 (i686) Kernel: Linux 2.6.15.2 Locale: LANG=en_US, LC_CTYPE=en_US (charmap=ISO-8859-1) Versions of packages asterisk depends on: ii adduser3.63 Add and remove users and groups ii asterisk-config1:1.2.1.dfsg-3config files for asterisk ii asterisk-sounds-main 1:1.2.1.dfsg-3sound files for asterisk ii libasound2 1.0.8-3 ALSA library ii libc6 2.3.2.ds1-22 GNU C Library: Shared libraries an ii libcurl3 7.13.2-2sarge4Multi-protocol file transfer libra ii libgsm11.0.10-13 Shared libraries for GSM speech co ii libidn11 0.5.13-1.0GNU libidn library, implementation ii libncurses55.4-4 Shared libraries for terminal hand ii libnewt0.510.51.6-20 Not Erik's Windowing Toolkit - tex ii libpq3 7.4.7-6sarge1 PostgreSQL C client library ii libpri11.2.1-2 Primary Rate ISDN specification li ii libspeex1 1.1.6-2 The Speex Speech Codec ii libssl0.9.70.9.7e-3sarge1SSL shared libraries ii unixodbc 2.2.4-11 ODBC tools libraries ii zlib1g 1:1.2.2-4.sarge.2 compression library - runtime -- no debconf information ___ Pkg-voip-maintainers mailing list [EMAIL PROTECTED] http://lists.alioth.debian.org/mailman/listinfo/pkg-voip-maintainers -- Tzafrir Cohen icq#16849755 +972-50-7952406 [EMAIL PROTECTED] http://www.xorcom.com -- To UNSUBSCRIBE, email to [EMAIL PROTECTED] with a subject of unsubscribe. Trouble? Contact [EMAIL PROTECTED]
Bug#350907: sigsegv crash when closing akregator
-BEGIN PGP SIGNED MESSAGE- Hash: SHA1 Package: akregator Version: 3.5.0-5+b1 Severity: normal Hi, When I start akregator, it works OK. But when I close it from systray, it always crashes with signal 11 (SIGSEGV). Here is the backtrace of the KDE bug handler: - --backtrace-- (no debugging symbols found) Using host libthread_db library /lib/tls/i686/cmov/libthread_db.so.1. (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) [Thread debugging using libthread_db enabled] [New Thread -1241891968 (LWP 4595)] (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) (no debugging symbols found) [KCrash handler] #6 0xb7c99b8a in malloc_usable_size () from /lib/tls/i686/cmov/libc.so.6 #7 0xb7c9a117 in malloc_usable_size () from /lib/tls/i686/cmov/libc.so.6 #8 0xb7c9a622 in free () from /lib/tls/i686/cmov/libc.so.6 #9 0xb7e4b5b1 in operator delete () from /usr/lib/libstdc++.so.6 #10 0xb7e4b60d in operator delete[] () from /usr/lib/libstdc++.so.6 #11 0xb73af202 in QGDict::~QGDict () from /usr/lib/libqt-mt.so.3 #12 0xb709e9bb in QAsciiDictQMetaData const::~QAsciiDict () from /usr/lib/libqt-mt.so.3 #13 0xb709ea6a in QMemberDict::~QMemberDict () from /usr/lib/libqt-mt.so.3 #14 0xb709cdaa in QMetaObject::~QMetaObject () from /usr/lib/libqt-mt.so.3 #15 0xb709cce8 in QMetaObjectCleanUp::~QMetaObjectCleanUp () from /usr/lib/libqt-mt.so.3 #16 0xb746c01e in QTextEdit::qt_static_property () from /usr/lib/libqt-mt.so.3 #17 0xb7c60571 in __cxa_finalize () from /lib/tls/i686/cmov/libc.so.6 #18 0xb6fc06f3 in ?? () from /usr/lib/libqt-mt.so.3 #19 0xb7566fe0 in ?? () from /usr/lib/libqt-mt.so.3 #20 0x0045 in ?? () #21 0xbfc770d8 in ?? () #22 0xb6fc06ca in ?? () from /usr/lib/libqt-mt.so.3 #23 0xb7d6ac2f in ?? () #24 0xb75592d4 in ?? () from /usr/lib/libqt-mt.so.3 #25 0xbfc770e8 in ?? () #26 0xb7480f6a in _fini () from /usr/lib/libqt-mt.so.3 #27 0xb7480f6a in _fini () from /usr/lib/libqt-mt.so.3 #28 0xb7f6e7cc in _dl_rtld_di_serinfo () from /lib/ld-linux.so.2 #29 0xb7c60344 in exit () from /lib/tls/i686/cmov/libc.so.6 #30 0xb7c48eb8 in __libc_start_main () from /lib/tls/i686/cmov/libc.so.6 #31 0x08050051 in ?? () - --backtrace-- I use akregator 3.5.0-5+b1 on a Debian SID GNU/Linux system. If there's any further information I can provide, just let me know. Thanks a lot for this software. Regards, Ramiro Cano. - -- +--++ |(o_ powered |Death Master| |(o_ (o_ //\ by++ |(/)_ (\)_ V_/_ GNU/LiNUX | +---+---+ |GPG KEY| 6FAB 9799 C61A A7D2 A409| +---+ 8A53 6F6F 3938 AF95 93E1| | KeyID: 0xAF9593E1 (¡Verificar firma!) | +---+---+ |E-MAIL | EN PUNTO | +---+ ^^ ^ | | death_master ~~ hpn-sec ~ net | | death_master ~~ clubhackers ~ com | | death_master ~~ wadalbertia ~ com | | death_master ~~ forohxclive ~ org | | death.master ~~ telefonica ~ net | +---+---+ |URL| http://www.death-master.tk/ | +---+---+
