Hi again, I was using biojava-protein-disorder-4.1.0, when I used 4.2.6, it worked fine.
On Thu, Mar 2, 2017 at 1:18 AM, Srikanth Bezawada <[email protected]> wrote: > Hi BioJava, > > I get the following stack trace when I try to find disorder scores using > biojava protein disorder module. Can you please let me know the fix ? > Thanks in advance. > > > Exception in thread "main" java.lang.ExceptionInInitializerError > at biojavausage.BioJavaUsage.main(BioJavaUsage.java:*25*) > Caused by: java.util.InputMismatchException > at java.util.Scanner.throwFor(Scanner.java:864) > at java.util.Scanner.next(Scanner.java:1485) > at java.util.Scanner.nextInt(Scanner.java:2117) > at java.util.Scanner.nextInt(Scanner.java:2076) > at org.biojava.nbio.ronn.ModelLoader.loadModels(ModelLoader.java:175) > at org.biojava.nbio.ronn.Jronn.<clinit>(Jronn.java:55) > ... 1 more > > > > Here is the line *25* which is the same line from the test folder of > biojava github. > > float[] rawProbabilityScores = Jronn.getDisorderScores(new > FastaSequence("name", "LLRGRHLMNGTMIMRPWNFLNDHHFPKFFPHLIEQQAIWLADWWRKKHC" > + > "RPLPTRAPTMDQWDHFALIQKHWTANLWFLTFPFNDKWGWIWFLKDWTPGSADQAQRACTWFFCHGHDTN" + > "CQIIFEGRNAPERADPMWTGGLNKHIIARGHFFQSNKFHFLERKFCEMAEIERPNFTCRTLDCQKFPWDDP" > )); >
_______________________________________________ Biojava-l mailing list - [email protected] http://mailman.open-bio.org/mailman/listinfo/biojava-l
