Hi again,
I was using biojava-protein-disorder-4.1.0, when I used 4.2.6, it worked
fine.



On Thu, Mar 2, 2017 at 1:18 AM, Srikanth Bezawada <[email protected]>
wrote:

> Hi BioJava,
>
> I get the following stack trace when I try to find disorder scores using
> biojava protein disorder module. Can you please let me know the fix ?
> Thanks in advance.
>
>
> Exception in thread "main" java.lang.ExceptionInInitializerError
> at biojavausage.BioJavaUsage.main(BioJavaUsage.java:*25*)
> Caused by: java.util.InputMismatchException
> at java.util.Scanner.throwFor(Scanner.java:864)
> at java.util.Scanner.next(Scanner.java:1485)
> at java.util.Scanner.nextInt(Scanner.java:2117)
> at java.util.Scanner.nextInt(Scanner.java:2076)
> at org.biojava.nbio.ronn.ModelLoader.loadModels(ModelLoader.java:175)
> at org.biojava.nbio.ronn.Jronn.<clinit>(Jronn.java:55)
> ... 1 more
>
>
>
> Here is the line *25* which is the same line from the test folder of
> biojava github.
>
> float[] rawProbabilityScores = Jronn.getDisorderScores(new
> FastaSequence("name", "LLRGRHLMNGTMIMRPWNFLNDHHFPKFFPHLIEQQAIWLADWWRKKHC"
> +
> "RPLPTRAPTMDQWDHFALIQKHWTANLWFLTFPFNDKWGWIWFLKDWTPGSADQAQRACTWFFCHGHDTN" +
> "CQIIFEGRNAPERADPMWTGGLNKHIIARGHFFQSNKFHFLERKFCEMAEIERPNFTCRTLDCQKFPWDDP"
> ));
>
_______________________________________________
Biojava-l mailing list  -  [email protected]
http://mailman.open-bio.org/mailman/listinfo/biojava-l

Reply via email to