Modified: tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -13,147 +13,315 @@ # See the License for the specific language governing permissions and # limitations under the License. -# Default localized string information -# Localized this the Default Locale as is en_US +jasper.error.emptybodycontent.nonempty=According to TLD, tag [{0}] must be empty, but is not +jsp.engine.info=Jasper JSP 2.3 Engine +jsp.error.action.isnottagfile=[{0}] action can be used in tag files only +jsp.error.action.istagfile=[{0}] action cannot be used in a tag file +jsp.error.attempt_to_clear_flushed_buffer=Error: Attempt to clear a buffer that's already been flushed +jsp.error.attr.quoted=Attribute value should be quoted +jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute directive in tag file, attribute [{0}] does not accept any expressions +jsp.error.attribute.deferredmix=Cannot use both ${} and #{} EL expressions in the same attribute value +jsp.error.attribute.duplicate=Attribute qualified names must be unique within an element +jsp.error.attribute.invalidPrefix=The attribute prefix [{0}] does not correspond to any imported tag library +jsp.error.attribute.noequal=equal symbol expected +jsp.error.attribute.noescape=Attribute value [{0}] is quoted with [{1}] which must be escaped when used within the value +jsp.error.attribute.noquote=quote symbol expected +jsp.error.attribute.nowhitespace=The JSP specification requires that an attribute name is preceded by whitespace +jsp.error.attribute.null_name=Null attribute name +jsp.error.attribute.standard.non_rt_with_expr=The [{0}] attribute of the [{1}] standard action does not accept any expressions +jsp.error.attribute.unterminated=attribute value for [{0}] is not properly terminated +jsp.error.attributes.not.allowed=[{0}] must not have any attributes +jsp.error.bad.scratch.dir=The scratchDir you specified: [{0}] is unusable. +jsp.error.badStandardAction=Invalid standard action +jsp.error.bad_attribute=Attribute [{0}] invalid for tag [{1}] according to TLD +jsp.error.bad_tag=No tag [{0}] defined in tag library imported with prefix [{1}] +jsp.error.beans.nomethod=Cannot find a method to read property [{0}] in a bean of type [{1}] +jsp.error.beans.nomethod.setproperty=Cannot find a method to write property [{0}] of type [{1}] in a bean of type [{2}] +jsp.error.beans.noproperty=Cannot find any information on property [{0}] in a bean of type [{1}] +jsp.error.beans.nullbean=Attempted a bean operation on a null object. +jsp.error.beans.property.conversion=Unable to convert string [{0}] to class [{1}] for attribute [{2}]: [{3}] +jsp.error.beans.propertyeditor.notregistered=Property Editor not registered with the PropertyEditorManager +jsp.error.beans.setproperty.noindexset=Cannot set indexed property +jsp.error.bug48498=Unable to display JSP extract. Probably due to an XML parser bug (see Tomcat bug 48498 for details). +jsp.error.classname=Cannot determine classname from .class file +jsp.error.coerce_to_type=Cannot coerce value [{2}] to type [{1}] for attribute [{0}]. +jsp.error.compilation=Error compiling file: [{0}] [{1}] jsp.error.compiler=No Java compiler available jsp.error.compiler.config=No Java compiler available for configuration options compilerClassName: [{0}] and compiler: [{1}] -jsp.error.no.scratch.dir=The JSP engine is not configured with a scratch dir.\ -\n Please add "jsp.initparams=scratchdir=<dir-name>" \ -\n in the servlets.properties file for this context. -jsp.error.bad.scratch.dir=The scratchDir you specified: [{0}] is unusable. -jsp.message.scratch.dir.is=Scratch dir for the JSP engine is: [{0}] -jsp.message.parent_class_loader_is=Parent class loader is: [{0}] -jsp.message.dont.modify.servlets=IMPORTANT: Do not modify the generated servlets -jsp.error.unavailable=JSP has been marked unavailable -jsp.error.usebean.duplicate=useBean: Duplicate bean name: [{0}] +jsp.error.config_pagedir_encoding_mismatch=Page-encoding specified in jsp-property-group [{0}] is different from that specified in page directive [{1}] +jsp.error.corresponding.servlet=Generated servlet error:\n +jsp.error.could.not.add.taglibraries=Could not add one or more tag libraries. +jsp.error.data.file.processing=Error processing file [{0}] +jsp.error.data.file.read=Error reading file [{0}] +jsp.error.data.file.write=Error while writing data file +jsp.error.deferredmethodandvalue='deferredValue' and 'deferredMethod' cannot be both 'true' +jsp.error.deferredmethodsignaturewithoutdeferredmethod=Cannot specify a method signature if 'deferredMethod' is not 'true' +jsp.error.deferredvaluetypewithoutdeferredvalue=Cannot specify a value type if 'deferredValue' is not 'true' +jsp.error.directive.isnottagfile=[{0}] directive can only be used in a tag file +jsp.error.directive.istagfile=[{0}] directive cannot be used in a tag file +jsp.error.duplicate.name.jspattribute=The attribute [{0}] specified in the standard or custom action also appears as the value of the name attribute in the enclosed jsp:attribute +jsp.error.duplicateqname=An attribute with duplicate qualified name [{0}] was found. Attribute qualified names must be unique within an element. +jsp.error.dynamic.attributes.not.implemented=The [{0}] tag declares that it accepts dynamic attributes but does not implement the required interface +jsp.error.el.parse=[{0}] : [{1}] +jsp.error.el.template.deferred=#{...} is not allowed in template text +jsp.error.el_interpreter_class.instantiation=Failed to load or instantiate ELInterpreter class [{0}] +jsp.error.fallback.invalidUse=jsp:fallback must be a direct child of jsp:plugin +jsp.error.file.already.registered=Recursive include of file [{0}] +jsp.error.file.cannot.read=Cannot read file: [{0}] +jsp.error.file.not.found=File [{0}] not found +jsp.error.file.not.registered=file [{0}] not seen in include +jsp.error.flush=Exception occurred when flushing data +jsp.error.fragmentwithtype=Cannot specify both 'fragment' and 'type' attributes. If 'fragment' is present, 'type' is fixed as 'javax.servlet.jsp.tagext.JspFragment' +jsp.error.function.classnotfound=The class [{0}] specified in TLD for the function [{1}] cannot be found: [{2}] +jsp.error.include.exception=Unable to include [{0}] +jsp.error.include.tag=Invalid jsp:include tag +jsp.error.internal.filenotfound=Internal Error: File [{0}] not found +jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: [{0}] +jsp.error.invalid.attribute=[{0}] has invalid attribute: [{1}] +jsp.error.invalid.bean=The value for the useBean class attribute [{0}] is invalid. +jsp.error.invalid.directive=Invalid directive +jsp.error.invalid.expression=[{0}] contains invalid expression(s): [{1}] +jsp.error.invalid.implicit=Invalid implicit TLD for tag file at [{0}] +jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD for tag file at [{0}] jsp.error.invalid.scope=Illegal value of ''scope'' attribute: [{0}] (must be one of "page", "request", "session", or "application") -jsp.error.classname=Cannot determine classname from .class file +jsp.error.invalid.tagdir=Tag file directory [{0}] does not start with "/WEB-INF/tags" +jsp.error.invalid.version=Invalid JSP version defined for tag file at [{0}] +jsp.error.ise_on_clear=Illegal to clear() when buffer size == 0 +jsp.error.java.line.number=An error occurred at line: [{0}] in the generated java file: [{1}] +jsp.error.javac=Javac exception +jsp.error.javac.env=Environment: +jsp.error.jspbody.emptybody.only=The [{0}] tag can only have jsp:attribute in its body. +jsp.error.jspbody.invalidUse=jsp:body must be the subelement of a standard or custom action +jsp.error.jspbody.required=Must use jsp:body to specify tag body for [{0}] if jsp:attribute is used. +jsp.error.jspc.missingTarget=Missing target: Must specify -webapp or -uriroot, or one or more JSP pages +jsp.error.jspc.no_uriroot=The uriroot is not specified and cannot be located with the specified JSP file(s) +jsp.error.jspc.uriroot_not_dir=The -uriroot option must specify a pre-existing directory +jsp.error.jspelement.missing.name=Mandatory XML-style 'name' attribute missing +jsp.error.jspoutput.conflict=<jsp:output>: illegal to have multiple occurrences of [{0}] with different values (old: [{1}], new: [{2}]) +jsp.error.jspoutput.doctypenamesystem=<jsp:output>: 'doctype-root-element' and 'doctype-system' attributes must appear together +jsp.error.jspoutput.doctypepublicsystem=<jsp:output>: 'doctype-system' attribute must appear if 'doctype-public' attribute appears +jsp.error.jspoutput.invalidUse=<jsp:output> must not be used in standard syntax +jsp.error.jspoutput.nonemptybody=<jsp:output> must not have a body +jsp.error.jsproot.version.invalid=Invalid version number: [{0}], must be "1.2", "2.0", "2.1", "2.2" or "2.3" +jsp.error.jsptext.badcontent='<', when appears in the body of <jsp:text>, must be encapsulated within a CDATA +jsp.error.lastModified=Unable to determine last modified date for file [{0}] +jsp.error.library.invalid=JSP page is invalid according to library [{0}]: [{1}] +jsp.error.literal_with_void=A literal value was specified for attribute [{0}] that is defined as a deferred method with a return type of void. JSP.2.3.4 does not permit literal values in this case +jsp.error.loadclass.taghandler=Unable to load tag handler class [{0}] for tag [{1}] +jsp.error.location=line: [{0}], column: [{1}] +jsp.error.mandatory.attribute=[{0}]: Mandatory attribute [{1}] missing +jsp.error.missing.tagInfo=TagInfo object for [{0}] is missing from TLD +jsp.error.missing_attribute=According to the TLD or the tag file, attribute [{0}] is mandatory for tag [{1}] +jsp.error.missing_var_or_varReader=Missing 'var' or 'varReader' attribute +jsp.error.multiple.jsp=Cannot have multiple specifications of +jsp.error.namedAttribute.invalidUse=jsp:attribute must be the subelement of a standard or custom action +jsp.error.needAlternateJavaEncoding=Default java encoding [{0}] is invalid on your java platform. An alternate can be specified via the ''javaEncoding'' parameter of JspServlet. +jsp.error.nested.jspattribute=A jsp:attribute standard action cannot be nested within another jsp:attribute standard action +jsp.error.nested.jspbody=A jsp:body standard action cannot be nested within another jsp:body or jsp:attribute standard action +jsp.error.nested_jsproot=Nested <jsp:root> +jsp.error.no.more.content=End of content reached while more parsing required: tag nesting error? +jsp.error.no.scratch.dir=The JSP engine is not configured with a scratch dir.\n\ +\ Please add "jsp.initparams=scratchdir=<dir-name>" \n\ +\ in the servlets.properties file for this context. +jsp.error.no.scriptlets=Scripting elements ( <%!, <jsp:declaration, <%=, <jsp:expression, <%, <jsp:scriptlet ) are disallowed here. +jsp.error.noFunction=The function [{0}] cannot be located with the specified prefix +jsp.error.noFunctionMethod=Method [{0}] for function [{1}] not found in class [{2}] +jsp.error.non_null_tei_and_var_subelems=Tag [{0}] has one or more variable subelements and a TagExtraInfo class that returns one or more VariableInfo +jsp.error.not.in.template=[{0}] not allowed in a template text body. jsp.error.outputfolder=No output folder -jsp.error.data.file.write=Error while writing data file +jsp.error.overflow=Error: JSP Buffer overflow +jsp.error.page.conflict.autoflush=Page directive: illegal to have multiple occurrences of ''autoFlush'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.buffer=Page directive: illegal to have multiple occurrences of ''buffer'' with different values (old: [{0}], new: [{1}]) jsp.error.page.conflict.contenttype=Page directive: illegal to have multiple occurrences of ''contentType'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.deferredsyntaxallowedasliteral=Page directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.errorpage=Page directive: illegal to have multiple occurrences of ''errorPage'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.extends=Page directive: illegal to have multiple occurrences of ''extends'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.info=Page directive: illegal to have multiple occurrences of ''info'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.iselignored=Page directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.iserrorpage=Page directive: illegal to have multiple occurrences of ''isErrorPage'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.isthreadsafe=Page directive: illegal to have multiple occurrences of ''isThreadSafe'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.language=Page directive: illegal to have multiple occurrences of ''language'' with different values (old: [{0}], new: [{1}]) jsp.error.page.conflict.session=Page directive: illegal to have multiple occurrences of ''session'' with different values (old: [{0}], new: [{1}]) -jsp.error.page.invalid.session=Page directive: invalid value for session -jsp.error.page.conflict.buffer=Page directive: illegal to have multiple occurrences of ''buffer'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.conflict.trimdirectivewhitespaces=Page directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: [{0}], new: [{1}]) jsp.error.page.invalid.buffer=Page directive: invalid value for buffer -jsp.error.page.conflict.autoflush=Page directive: illegal to have multiple occurrences of ''autoFlush'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.invalid.deferredsyntaxallowedasliteral=Page directive: invalid value for deferredSyntaxAllowedAsLiteral jsp.error.page.invalid.import=Page directive: invalid value for import -jsp.error.page.conflict.isthreadsafe=Page directive: illegal to have multiple occurrences of ''isThreadSafe'' with different values (old: [{0}], new: [{1}]) -jsp.error.page.invalid.isthreadsafe=Page directive: invalid value for isThreadSafe -jsp.error.page.conflict.info=Page directive: illegal to have multiple occurrences of ''info'' with different values (old: [{0}], new: [{1}]) jsp.error.page.invalid.info=Page directive: invalid value for info -jsp.error.page.conflict.iserrorpage=Page directive: illegal to have multiple occurrences of ''isErrorPage'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.invalid.iselignored=Page directive: invalid value for isELIgnored jsp.error.page.invalid.iserrorpage=Page directive: invalid value for isErrorPage -jsp.error.page.conflict.errorpage=Page directive: illegal to have multiple occurrences of ''errorPage'' with different values (old: [{0}], new: [{1}]) -jsp.error.page.conflict.language=Page directive: illegal to have multiple occurrences of ''language'' with different values (old: [{0}], new: [{1}]) -jsp.error.tag.conflict.language=Tag directive: illegal to have multiple occurrences of ''language'' with different values (old: [{0}], new: [{1}]) +jsp.error.page.invalid.isthreadsafe=Page directive: invalid value for isThreadSafe +jsp.error.page.invalid.session=Page directive: invalid value for session +jsp.error.page.invalid.trimdirectivewhitespaces=Page directive: invalid value for trimDirectiveWhitespaces jsp.error.page.language.nonjava=Page directive: invalid language attribute -jsp.error.tag.language.nonjava=Tag directive: invalid language attribute -jsp.error.page.conflict.extends=Page directive: illegal to have multiple occurrences of ''extends'' with different values (old: [{0}], new: [{1}]) -jsp.error.page.conflict.iselignored=Page directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}]) -jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}]) -jsp.error.page.invalid.iselignored=Page directive: invalid value for isELIgnored -jsp.error.tag.invalid.iselignored=Tag directive: invalid value for isELIgnored jsp.error.page.multi.pageencoding=Page directive must not have multiple occurrences of pageencoding -jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple occurrences of the attribute [{0}] with different values (old: [{1}], new: [{2}]) -jsp.error.tag.multi.pageencoding=Tag directive must not have multiple occurrences of pageencoding -jsp.error.include.exception=Unable to include [{0}] -jsp.error.stream.close.failed=Failed to close stream -jsp.error.stream.closed=Stream closed -jsp.error.invalid.directive=Invalid directive -jsp.error.invalid.implicit=Invalid implicit TLD for tag file at [{0}] -jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD for tag file at [{0}] -jsp.error.invalid.version=Invalid JSP version defined for tag file at [{0}] -jsp.error.directive.istagfile=[{0}] directive cannot be used in a tag file -jsp.error.directive.isnottagfile=[{0}] directive can only be used in a tag file -jsp.error.action.istagfile=[{0}] action cannot be used in a tag file -jsp.error.action.isnottagfile=[{0}] action can be used in tag files only -jsp.error.unterminated=Unterminated [{0}] tag -jsp.error.loadclass.taghandler=Unable to load tag handler class [{0}] for tag [{1}] -jsp.error.unable.compile=Unable to compile class for JSP -jsp.error.unable.load=Unable to load class for JSP -jsp.error.mandatory.attribute=[{0}]: Mandatory attribute [{1}] missing -jsp.error.flush=Exception occurred when flushing data -jsp.engine.info=Jasper JSP 2.3 Engine -jsp.error.invalid.expression=[{0}] contains invalid expression(s): [{1}] -jsp.error.invalid.attribute=[{0}] has invalid attribute: [{1}] -jsp.error.file.cannot.read=Cannot read file: [{0}] -jsp.error.file.already.registered=Recursive include of file [{0}] -jsp.error.file.not.registered=file [{0}] not seen in include -jsp.error.quotes.unterminated=Unterminated quotes -jsp.error.attr.quoted=Attribute value should be quoted -jsp.error.beans.nullbean=Attempted a bean operation on a null object. -jsp.error.beans.nomethod=Cannot find a method to read property [{0}] in a bean of type [{1}] -jsp.error.beans.nomethod.setproperty=Cannot find a method to write property [{0}] of type [{1}] in a bean of type [{2}] -jsp.error.beans.noproperty=Cannot find any information on property [{0}] in a bean of type [{1}] -jsp.error.beans.property.conversion=Unable to convert string [{0}] to class [{1}] for attribute [{2}]: [{3}] -jsp.error.beans.propertyeditor.notregistered=Property Editor not registered with the PropertyEditorManager -jsp.error.beans.setproperty.noindexset=Cannot set indexed property -jsp.error.include.tag=Invalid jsp:include tag -jsp.error.attempt_to_clear_flushed_buffer=Error: Attempt to clear a buffer that's already been flushed -jsp.error.overflow=Error: JSP Buffer overflow -jsp.error.paramexpected=Expecting "jsp:param" standard action with "name" and "value" attributes +jsp.error.page.noSession=Cannot access session scope in page that does not participate in any session jsp.error.param.invalidUse=The jsp:param action must not be used outside the jsp:include, jsp:forward, or jsp:params elements -jsp.error.params.invalidUse=jsp:params must be a direct child of jsp:plugin -jsp.error.fallback.invalidUse=jsp:fallback must be a direct child of jsp:plugin -jsp.error.namedAttribute.invalidUse=jsp:attribute must be the subelement of a standard or custom action -jsp.error.jspbody.invalidUse=jsp:body must be the subelement of a standard or custom action +jsp.error.paramexpected=Expecting "jsp:param" standard action with "name" and "value" attributes jsp.error.params.emptyBody=jsp:params must contain at least one nested jsp:param -jsp.error.plugin.notype=type not declared in jsp:plugin +jsp.error.params.invalidUse=jsp:params must be a direct child of jsp:plugin +jsp.error.parse.error.in.TLD=Parse Error in the tag library descriptor: [{0}] +jsp.error.parse.xml=XML parsing error on file [{0}] +jsp.error.parse.xml.invalidPublicId=Invalid PUBLIC ID: [{0}] +jsp.error.parse.xml.line=XML parsing error on file [{0}]: (line [{1}], col [{2}]) +jsp.error.parse.xml.scripting.invalid.body=Body of [{0}] element must not contain any XML elements jsp.error.plugin.badtype=Illegal value for 'type' attribute in jsp:plugin: must be 'bean' or 'applet' jsp.error.plugin.nocode=code not declared in jsp:plugin -jsp.error.ise_on_clear=Illegal to clear() when buffer size == 0 -jsp.error.javac=Javac exception -jsp.error.javac.env=Environment: -jsp.error.compilation=Error compiling file: [{0}] [{1}] +jsp.error.plugin.notype=type not declared in jsp:plugin +jsp.error.plugin.wrongRootElement=Name of root element in [{0}] different from [{1}] +jsp.error.prefix.refined=Attempt to redefine the prefix [{0}] to [{1}], when it was already defined as [{2}] in the current scope. +jsp.error.prefix.use_before_dcl=The prefix [{0}] specified in this tag directive has been previously used by an action in file [{1}] line [{2}]. +jsp.error.prolog_config_encoding_mismatch=Page-encoding specified in XML prolog [{0}] is different from that specified in jsp-property-group [{1}] +jsp.error.prolog_pagedir_encoding_mismatch=Page-encoding specified in XML prolog [{0}] is different from that specified in page directive [{1}] +jsp.error.quotes.unterminated=Unterminated quotes +jsp.error.scripting.variable.missing_name=Unable to determine scripting variable name from attribute [{0}] +jsp.error.servlet.destroy.failed=Exception during Servlet.destroy() for JSP page +jsp.error.servlet.invalid.method=JSPs only permit GET, POST or HEAD. Jasper also permits OPTIONS +jsp.error.setLastModified=Unable to set last modified date for file [{0}] +jsp.error.signature.classnotfound=The class [{0}] specified in the method signature in TLD for the function [{1}] cannot be found. [{2}] +jsp.error.simpletag.badbodycontent=The TLD for the class [{0}] specifies an invalid body-content (JSP) for a SimpleTag. +jsp.error.single.line.number=An error occurred at line: [{0}] in the jsp file: [{1}] +jsp.error.stream.close.failed=Failed to close stream +jsp.error.stream.closed=Stream closed +jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple occurrences of the attribute [{0}] with different values (old: [{1}], new: [{2}]) +jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: [{0}], new: [{1}]) +jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}]) +jsp.error.tag.conflict.language=Tag directive: illegal to have multiple occurrences of ''language'' with different values (old: [{0}], new: [{1}]) +jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: [{0}], new: [{1}]) +jsp.error.tag.invalid.deferredsyntaxallowedasliteral=Tag directive: invalid value for deferredSyntaxAllowedAsLiteral +jsp.error.tag.invalid.iselignored=Tag directive: invalid value for isELIgnored +jsp.error.tag.invalid.trimdirectivewhitespaces=Tag directive: invalid value for trimDirectiveWhitespaces +jsp.error.tag.language.nonjava=Tag directive: invalid language attribute +jsp.error.tag.multi.pageencoding=Tag directive must not have multiple occurrences of pageencoding +jsp.error.tagdirective.badbodycontent=Invalid body-content [{0}] in tag directive +jsp.error.tagfile.badSuffix=Missing ".tag" suffix in tag file path [{0}] +jsp.error.tagfile.illegalPath=Illegal tag file path: [{0}], must start with "/WEB-INF/tags" or "/META-INF/tags" +jsp.error.tagfile.missingPath=Path not specified to tag file +jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in line [{1}] and whose name attribute is [{0}], the value of this name-from-attribute attribute) must be of type java.lang.String, is "required" and not a "rtexprvalue". +jsp.error.tagfile.nameFrom.noAttribute=Cannot find an attribute directive with a name attribute with a value [{0}], the value of this name-from-attribute attribute. +jsp.error.tagfile.nameNotUnique=The value of [{0}] and the value of [{1}] in line [{2}] are the same. +jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: [{0}] cannot be resolved in either web.xml or the jar files deployed with this application +jsp.error.taglibDirective.both_uri_and_tagdir=Both 'uri' and 'tagdir' attributes specified +jsp.error.taglibDirective.missing.location=Neither 'uri' nor 'tagdir' attribute specified +jsp.error.taglibDirective.uriInvalid=The URI provided for a tag library [{0}] is not a valid URI +jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo for [{0}] +jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo class: [{0}] +jsp.error.text.has_subelement=<jsp:text> must not have any subelements +jsp.error.tld.fn.duplicate.name=Duplicate function name [{0}] in tag library [{1}] +jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in TLD. Tag Library: [{0}], Function: [{1}] +jsp.error.tld.invalid_tld_file=Invalid tld file: [{0}], see JSP specification section 7.3.1 for more details +jsp.error.tld.mandatory.element.missing=Mandatory TLD element [{0}] missing or empty in TLD [{1}] +jsp.error.tld.missing=Unable to find taglib [{0}] for URI: [{1}] +jsp.error.tld.missing_jar=Missing JAR resource [{0}] containing TLD +jsp.error.tld.unable_to_get_jar=Unable to get JAR resource [{0}] containing TLD: [{1}] +jsp.error.tlv.invalid.page=Validation error messages from TagLibraryValidator for [{0}] in [{1}] +jsp.error.tlvclass.instantiation=Failed to load or instantiate TagLibraryValidator class: [{0}] +jsp.error.unable.compile=Unable to compile class for JSP +jsp.error.unable.load=Unable to load class for JSP +jsp.error.unable.to_find_method=Unable to find setter method for attribute: [{0}] +jsp.error.unavailable=JSP has been marked unavailable +jsp.error.unbalanced.endtag=The end tag "</{0}" is unbalanced jsp.error.undeclared_namespace=A custom tag was encountered with an undeclared namespace [{0}] -jsp.warning.classpathUrl=Invalid URL found in class path. This URL will be ignored -jsp.warning.keepgen=Warning: Invalid value for the initParam keepgenerated. Will use the default value of "false" -jsp.warning.xpoweredBy=Warning: Invalid value for the initParam xpoweredBy. Will use the default value of "false" -jsp.warning.enablePooling=Warning: Invalid value for the initParam enablePooling. Will use the default value of "true" -jsp.warning.mappedFile=Warning: Invalid value for the initParam mappedFile. Will use the default value of "false" -jsp.warning.classDebugInfo=Warning: Invalid value for the initParam classdebuginfo. Will use the default value of "false" +jsp.error.unknown_attribute_type=Unknown attribute type [{1}] for attribute [{0}]. +jsp.error.unsupported.encoding=Unsupported encoding: [{0}] +jsp.error.unterminated=Unterminated [{0}] tag +jsp.error.usebean.duplicate=useBean: Duplicate bean name: [{0}] +jsp.error.usebean.noSession=Illegal for useBean to use session scope when JSP page declares (via page directive) that it does not participate in sessions +jsp.error.var_and_varReader=Only one of 'var' or 'varReader' may be specified +jsp.error.variable.alias=Both or none of the name-from-attribute and alias attributes must be specified in a variable directive +jsp.error.variable.both.name=Cannot specify both name-given or name-from-attribute attributes in a variable directive +jsp.error.variable.either.name=Either name-given or name-from-attribute attribute must be specified in a variable directive +jsp.error.xml.badStandardAction=Invalid standard action: [{0}] +jsp.error.xml.bad_tag=No tag [{0}] defined in tag library associated with uri [{1}] +jsp.error.xml.closeQuoteMissingInTextDecl=closing quote in the value following [{0}] in the text declaration is missing. +jsp.error.xml.closeQuoteMissingInXMLDecl=closing quote in the value following [{0}] in the XML declaration is missing. +jsp.error.xml.encodingByteOrderUnsupported=Given byte order for encoding [{0}] is not supported. +jsp.error.xml.encodingDeclInvalid=Invalid encoding name [{0}]. +jsp.error.xml.encodingDeclRequired=The encoding declaration is required in the text declaration. +jsp.error.xml.eqRequiredInTextDecl=The '' = '' character must follow [{0}] in the text declaration. +jsp.error.xml.eqRequiredInXMLDecl=The '' = '' character must follow [{0}] in the XML declaration. +jsp.error.xml.expectedByte=Expected byte [{0}] of [{1}]-byte UTF-8 sequence. +jsp.error.xml.invalidASCII=Byte [{0}] not 7-bit ASCII. +jsp.error.xml.invalidByte=Invalid byte [{0}] of [{1}]-byte UTF-8 sequence. +jsp.error.xml.invalidCharInContent=An invalid XML character (Unicode: 0x[{0}]) was found in the element content of the document. +jsp.error.xml.invalidCharInPI=An invalid XML character (Unicode: 0x[{0}]) was found in the processing instruction. +jsp.error.xml.invalidCharInTextDecl=An invalid XML character (Unicode: 0x[{0}]) was found in the text declaration. +jsp.error.xml.invalidCharInXMLDecl=An invalid XML character (Unicode: 0x[{0}]) was found in the XML declaration. +jsp.error.xml.invalidHighSurrogate=High surrogate bits in UTF-8 sequence must not exceed 0x10 but found 0x[{0}]. +jsp.error.xml.morePseudoAttributes=more pseudo attributes is expected. +jsp.error.xml.noMorePseudoAttributes=no more pseudo attributes is allowed. +jsp.error.xml.operationNotSupported=Operation [{0}] not supported by [{1}] reader. +jsp.error.xml.pseudoAttrNameExpected=a pseudo attribute name is expected. +jsp.error.xml.quoteRequiredInTextDecl=The value following [{0}] in the text declaration must be a quoted string. +jsp.error.xml.quoteRequiredInXMLDecl=The value following [{0}] in the XML declaration must be a quoted string. +jsp.error.xml.reservedPITarget=The processing instruction target matching "[xX][mM][lL]" is not allowed. +jsp.error.xml.sdDeclInvalid=The standalone document declaration value must be "yes" or "no", not [{0}]. +jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl=White space is required before the encoding pseudo attribute in the text declaration. +jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl=White space is required before the encoding pseudo attribute in the XML declaration. +jsp.error.xml.spaceRequiredBeforeStandalone=White space is required before the encoding pseudo attribute in the XML declaration. +jsp.error.xml.spaceRequiredBeforeVersionInTextDecl=White space is required before the version pseudo attribute in the text declaration. +jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl=White space is required before the version pseudo attribute in the XML declaration. +jsp.error.xml.spaceRequiredInPI=White space is required between the processing instruction target and data. +jsp.error.xml.versionInfoRequired=The version is required in the XML declaration. +jsp.error.xml.versionNotSupported=XML version [{0}] is not supported, only XML 1.0 is supported. +jsp.error.xml.xmlDeclUnterminated=The XML declaration must end with "?>". +jsp.exception=An exception occurred processing [{0}] at line [{1}] +jsp.info.ignoreSetting=Ignored setting for [{0}] of [{1}] because a SecurityManager was enabled +jsp.message.dont.modify.servlets=IMPORTANT: Do not modify the generated servlets +jsp.message.jsp_added=Adding JSP for path [{0}] to queue of context [{1}] +jsp.message.jsp_queue_created=Created jsp queue with length [{0}] for context [{1}] +jsp.message.jsp_queue_update=Updating JSP for path [{0}] in queue of context [{1}] +jsp.message.jsp_removed_excess=Removing excess JSP for path [{0}] from queue of context [{1}] +jsp.message.jsp_removed_idle=Removing idle JSP for path [{0}] in context [{1}] after [{2}] seconds"); +jsp.message.jsp_unload_check=Checking JSPs for unload in context [{0}], JSP count: [{1}] queue length: [{2}] +jsp.message.parent_class_loader_is=Parent class loader is: [{0}] +jsp.message.scratch.dir.is=Scratch dir for the JSP engine is: [{0}] +jsp.tldCache.noTldInDir=No TLD files were found in directory [{0}]. +jsp.tldCache.noTldInJar=No TLD files were found in [{0}]. Consider adding the JAR to the tomcat.util.scan.StandardJarScanFilter.jarsToSkip property in CATALINA_BASE/conf/catalina.properties file. +jsp.tldCache.noTldInResourcePath=No TLD files were found in resource path [{0}]. +jsp.tldCache.noTldSummary=At least one JAR was scanned for TLDs yet contained no TLDs. Enable debug logging for this logger for a complete list of JARs that were scanned but no TLDs were found in them. Skipping unneeded JARs during scanning can improve startup time and JSP compilation time. +jsp.tldCache.tldInDir=TLD files were found in directory [{0}]. +jsp.tldCache.tldInJar=TLD files were found in JAR [{0}]. +jsp.tldCache.tldInResourcePath=TLD files were found in resource path [{0}]. +jsp.warning.bad.urlpattern.propertygroup=Bad value [{0}] in the url-pattern subelement in web.xml jsp.warning.checkInterval=Warning: Invalid value for the initParam checkInterval. Will use the default value of "300" seconds -jsp.warning.modificationTestInterval=Warning: Invalid value for the initParam modificationTestInterval. Will use the default value of "4" seconds -jsp.warning.recompileOnFail=Warning: Invalid value for the initParam recompileOnFail. Will use the default value of "false" +jsp.warning.classDebugInfo=Warning: Invalid value for the initParam classdebuginfo. Will use the default value of "false" +jsp.warning.classpathUrl=Invalid URL found in class path. This URL will be ignored +jsp.warning.compiler.classfile.delete.fail=Failed to delete generated class file [{0}] +jsp.warning.compiler.classfile.delete.fail.unknown=Failed to delete generated class file(s) +jsp.warning.compiler.javafile.delete.fail=Failed to delete generated Java file [{0}] jsp.warning.development=Warning: Invalid value for the initParam development. Will use the default value of "true" -jsp.warning.fork=Warning: Invalid value for the initParam fork. Will use the default value of "true" +jsp.warning.displaySourceFragment=Warning: Invalid value for the initParam displaySourceFragment. Will use the default value of "true" jsp.warning.dumpSmap=Warning: Invalid value for the initParam dumpSmap. Will use the default value of "false" -jsp.warning.loadSmap=Unable to load SMAP data for class [{0}] +jsp.warning.enablePooling=Warning: Invalid value for the initParam enablePooling. Will use the default value of "true" +jsp.warning.fork=Warning: Invalid value for the initParam fork. Will use the default value of "true" jsp.warning.genchararray=Warning: Invalid value for the initParam genStringAsCharArray. Will use the default value of "false" -jsp.warning.suppressSmap=Warning: Invalid value for the initParam suppressSmap. Will use the default value of "false" -jsp.warning.displaySourceFragment=Warning: Invalid value for the initParam displaySourceFragment. Will use the default value of "true" -jsp.warning.maxLoadedJsps=Warning: Invalid value for the initParam maxLoadedJsps. Will use the default value of "-1" jsp.warning.jspIdleTimeout=Warning: Invalid value for the initParam jspIdleTimeout. Will use the default value of "-1" -jsp.warning.strictQuoteEscaping=Warning: Invalid value for the initParam strictQuoteEscaping. Will use the default value of "true" +jsp.warning.keepgen=Warning: Invalid value for the initParam keepgenerated. Will use the default value of "false" +jsp.warning.loadSmap=Unable to load SMAP data for class [{0}] +jsp.warning.mappedFile=Warning: Invalid value for the initParam mappedFile. Will use the default value of "false" +jsp.warning.maxLoadedJsps=Warning: Invalid value for the initParam maxLoadedJsps. Will use the default value of "-1" +jsp.warning.modificationTestInterval=Warning: Invalid value for the initParam modificationTestInterval. Will use the default value of "4" seconds +jsp.warning.noJarScanner=Warning: No org.apache.tomcat.JarScanner set in ServletContext. Falling back to default JarScanner implementation. jsp.warning.quoteAttributeEL=Warning: Invalid value for the initParam quoteAttributeEL. Will use the default value of "false" -jsp.warning.unknown.element.in.taglib=Unknown element [{0}] in taglib +jsp.warning.recompileOnFail=Warning: Invalid value for the initParam recompileOnFail. Will use the default value of "false" +jsp.warning.strictQuoteEscaping=Warning: Invalid value for the initParam strictQuoteEscaping. Will use the default value of "true" +jsp.warning.suppressSmap=Warning: Invalid value for the initParam suppressSmap. Will use the default value of "false" +jsp.warning.unknown.element.in.attribute=Unknown element [{0}] in attribute +jsp.warning.unknown.element.in.function=Unknown element [{0}] in function +jsp.warning.unknown.element.in.initParam=Unknown element [{0}] in validator''s init-param jsp.warning.unknown.element.in.tag=Unknown element [{0}] in tag jsp.warning.unknown.element.in.tagfile=Unknown element [{0}] in tag-file -jsp.warning.unknown.element.in.attribute=Unknown element [{0}] in attribute -jsp.warning.unknown.element.in.variable=Unknown element [{0}] in variable +jsp.warning.unknown.element.in.taglib=Unknown element [{0}] in taglib jsp.warning.unknown.element.in.validator=Unknown element [{0}] in validator -jsp.warning.unknown.element.in.initParam=Unknown element [{0}] in validator''s init-param -jsp.warning.unknown.element.in.function=Unknown element [{0}] in function -jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo class: [{0}] -jsp.error.non_null_tei_and_var_subelems=Tag [{0}] has one or more variable subelements and a TagExtraInfo class that returns one or more VariableInfo -jsp.error.parse.error.in.TLD=Parse Error in the tag library descriptor: [{0}] -jsp.error.file.not.found=File [{0}] not found -jsp.error.missing_attribute=According to the TLD or the tag file, attribute [{0}] is mandatory for tag [{1}] -jsp.error.bad_attribute=Attribute [{0}] invalid for tag [{1}] according to TLD -jsp.error.tld.unable_to_get_jar=Unable to get JAR resource [{0}] containing TLD: [{1}] -jsp.error.tld.missing=Unable to find taglib [{0}] for URI: [{1}] -jsp.error.tld.missing_jar=Missing JAR resource [{0}] containing TLD -jsp.error.tld.invalid_tld_file=Invalid tld file: [{0}], see JSP specification section 7.3.1 for more details -jsp.error.unable.to_find_method=Unable to find setter method for attribute: [{0}] -jsp.error.bad_tag=No tag [{0}] defined in tag library imported with prefix [{1}] -jsp.error.xml.bad_tag=No tag [{0}] defined in tag library associated with uri [{1}] -jsp.warning.compiler.classfile.delete.fail=Failed to delete generated class file [{0}] -jsp.warning.compiler.classfile.delete.fail.unknown=Failed to delete generated class file(s) -jsp.warning.compiler.javafile.delete.fail=Failed to delete generated Java file [{0}] -jsp.error.jspc.uriroot_not_dir=The -uriroot option must specify a pre-existing directory -jsp.error.jspc.missingTarget=Missing target: Must specify -webapp or -uriroot, or one or more JSP pages -jsp.error.jspc.no_uriroot=The uriroot is not specified and cannot be located with the specified JSP file(s) +jsp.warning.unknown.element.in.variable=Unknown element [{0}] in variable +jsp.warning.xpoweredBy=Warning: Invalid value for the initParam xpoweredBy. Will use the default value of "false" + +jspc.delete.fail=Failed to delete file [{0}] +jspc.error.fileDoesNotExist=The file argument [{0}] does not exist +jspc.error.generalException=ERROR-the file [{0}] generated the following general exception: +jspc.error.invalidFragment=Aborting pre-compilation due to errors in web fragments +jspc.error.invalidWebXml=Aborting pre-compilation due to errors in web.xml jspc.generation.result=Generation completed with [{0}] errors in [{1}] milliseconds jspc.implicit.uriRoot=uriRoot implicitly set to [{0}] jspc.usage=Usage: jspc <options> [--] <jsp files>\n\ @@ -193,24 +361,12 @@ where options include:\n\ \ -source <version> Set the -source argument to the compiler (default 1.8)\n\ \ -target <version> Set the -target argument to the compiler (default 1.8)\n\ \ -threadCount <count> Number of threads to use for compilation.\n\ -\ (\"2.0C\" means two threads per core)\n\ - -jspc.webxml.header=<?xml version="1.0" encoding="{0}"?>\n\ -\<web-app xmlns="http://xmlns.jcp.org/xml/ns/javaee"\n\ -\ xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"\n\ -\ xsi:schemaLocation="http://xmlns.jcp.org/xml/ns/javaee\n\ -\ http://xmlns.jcp.org/xml/ns/javaee/web-app_4_0.xsd"\n\ -\ version="4.0"\n\ -\ metadata-complete="false">\n\ -<!--\n\ -Automatically created by Apache Tomcat JspC.\n\ --->\n\ -\n -jspc.webxml.footer=\n\ -</web-app>\n\ +\ ("2.0C" means two threads per core)\n +jspc.webfrg.footer=\n\ +</web-fragment>\n\ \n jspc.webfrg.header=<?xml version="1.0" encoding="{0}"?>\n\ -\<web-fragment xmlns="http://xmlns.jcp.org/xml/ns/javaee"\n\ +<web-fragment xmlns="http://xmlns.jcp.org/xml/ns/javaee"\n\ \ xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"\n\ \ xsi:schemaLocation="http://xmlns.jcp.org/xml/ns/javaee\n\ \ http://xmlns.jcp.org/xml/ns/javaee/web-fragment_4_0.xsd"\n\ @@ -222,217 +378,37 @@ jspc.webfrg.header=<?xml version="1.0" e Automatically created by Apache Tomcat JspC.\n\ -->\n\ \n -jspc.webfrg.footer=\n\ -</web-fragment>\n\ -\n -jspc.webinc.header=\n\ -<!--\n\ -Automatically created by Apache Tomcat JspC.\n\ --->\n jspc.webinc.footer=\n\ <!--\n\ End of content automatically created by Apache Tomcat JspC.\n\ -->\n +jspc.webinc.header=\n\ +<!--\n\ +Automatically created by Apache Tomcat JspC.\n\ +-->\n jspc.webinc.insertEnd=<!-- JSPC servlet mappings end --> jspc.webinc.insertStart=<!-- JSPC servlet mappings start --> -jspc.error.generalException=ERROR-the file [{0}] generated the following general exception: -jspc.error.fileDoesNotExist=The file argument [{0}] does not exist -jspc.delete.fail=Failed to delete file [{0}] -jspc.error.invalidWebXml=Aborting pre-compilation due to errors in web.xml -jspc.error.invalidFragment=Aborting pre-compilation due to errors in web fragments -jsp.error.library.invalid=JSP page is invalid according to library [{0}]: [{1}] -jsp.error.tlvclass.instantiation=Failed to load or instantiate TagLibraryValidator class: [{0}] -jsp.error.tlv.invalid.page=Validation error messages from TagLibraryValidator for [{0}] in [{1}] -jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo for [{0}] -jsp.error.no.more.content=End of content reached while more parsing required: tag nesting error? -jsp.error.parse.xml=XML parsing error on file [{0}] -jsp.error.parse.xml.line=XML parsing error on file [{0}]: (line [{1}], col [{2}]) -jsp.error.parse.xml.scripting.invalid.body=Body of [{0}] element must not contain any XML elements -jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: [{0}] -jsp.error.internal.filenotfound=Internal Error: File [{0}] not found -jsp.error.parse.xml.invalidPublicId=Invalid PUBLIC ID: [{0}] -jsp.error.unsupported.encoding=Unsupported encoding: [{0}] -jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: [{0}] cannot be resolved in either web.xml or the jar files deployed with this application -jsp.error.taglibDirective.uriInvalid=The URI provided for a tag library [{0}] is not a valid URI -jsp.error.taglibDirective.missing.location=Neither 'uri' nor 'tagdir' attribute specified -jsp.error.taglibDirective.both_uri_and_tagdir=Both 'uri' and 'tagdir' attributes specified -jsp.error.invalid.tagdir=Tag file directory [{0}] does not start with "/WEB-INF/tags" -#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}> cannot have template data. Template data must be encapsulated within a <jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error: [{1}] -#Error while processing taglib jar file [{0}]: [{1}] -jsp.error.needAlternateJavaEncoding=Default java encoding [{0}] is invalid on your java platform. An alternate can be specified via the ''javaEncoding'' parameter of JspServlet. -#Error when compiling, used for jsp line number error messages -jsp.error.single.line.number=An error occurred at line: [{0}] in the jsp file: [{1}] -jsp.error.java.line.number=An error occurred at line: [{0}] in the generated java file: [{1}] -jsp.error.location=line: [{0}], column: [{1}] -jsp.error.corresponding.servlet=Generated servlet error:\n -jsp.error.jspbody.required=Must use jsp:body to specify tag body for [{0}] if jsp:attribute is used. -jsp.error.jspbody.emptybody.only=The [{0}] tag can only have jsp:attribute in its body. -jsp.error.no.scriptlets=Scripting elements ( <%!, <jsp:declaration, <%=, <jsp:expression, <%, <jsp:scriptlet ) are disallowed here. -jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in TLD. Tag Library: [{0}], Function: [{1}] -jsp.error.tld.fn.duplicate.name=Duplicate function name [{0}] in tag library [{1}] -jsp.error.tld.mandatory.element.missing=Mandatory TLD element [{0}] missing or empty in TLD [{1}] -jsp.error.dynamic.attributes.not.implemented=The [{0}] tag declares that it accepts dynamic attributes but does not implement the required interface -jsp.error.attribute.noequal=equal symbol expected -jsp.error.attribute.noquote=quote symbol expected -jsp.error.attribute.unterminated=attribute value for [{0}] is not properly terminated -jsp.error.attribute.noescape=Attribute value [{0}] is quoted with [{1}] which must be escaped when used within the value -jsp.error.attribute.nowhitespace=The JSP specification requires that an attribute name is preceded by whitespace -jsp.error.attribute.duplicate=Attribute qualified names must be unique within an element -jsp.error.missing.tagInfo=TagInfo object for [{0}] is missing from TLD -jsp.error.deferredmethodsignaturewithoutdeferredmethod=Cannot specify a method signature if 'deferredMethod' is not 'true' -jsp.error.deferredvaluetypewithoutdeferredvalue=Cannot specify a value type if 'deferredValue' is not 'true' -jsp.error.deferredmethodandvalue='deferredValue' and 'deferredMethod' cannot be both 'true' -jsp.error.fragmentwithtype=Cannot specify both 'fragment' and 'type' attributes. If 'fragment' is present, 'type' is fixed as 'javax.servlet.jsp.tagext.JspFragment' -jsp.error.var_and_varReader=Only one of 'var' or 'varReader' may be specified -jsp.error.missing_var_or_varReader=Missing 'var' or 'varReader' attribute -jsp.warning.bad.urlpattern.propertygroup=Bad value [{0}] in the url-pattern subelement in web.xml -jsp.error.literal_with_void=A literal value was specified for attribute [{0}] that is defined as a deferred method with a return type of void. JSP.2.3.4 does not permit literal values in this case -jsp.error.unknown_attribute_type=Unknown attribute type [{1}] for attribute [{0}]. -jsp.error.coerce_to_type=Cannot coerce value [{2}] to type [{1}] for attribute [{0}]. -jsp.error.jspelement.missing.name=Mandatory XML-style 'name' attribute missing -jsp.error.could.not.add.taglibraries=Could not add one or more tag libraries. -jsp.error.duplicate.name.jspattribute=The attribute [{0}] specified in the standard or custom action also appears as the value of the name attribute in the enclosed jsp:attribute -jsp.error.not.in.template=[{0}] not allowed in a template text body. -jsp.error.badStandardAction=Invalid standard action -jsp.error.xml.badStandardAction=Invalid standard action: [{0}] -jsp.error.tagdirective.badbodycontent=Invalid body-content [{0}] in tag directive -jsp.error.simpletag.badbodycontent=The TLD for the class [{0}] specifies an invalid body-content (JSP) for a SimpleTag. -jsp.error.config_pagedir_encoding_mismatch=Page-encoding specified in jsp-property-group [{0}] is different from that specified in page directive [{1}] -jsp.error.prolog_pagedir_encoding_mismatch=Page-encoding specified in XML prolog [{0}] is different from that specified in page directive [{1}] -jsp.error.prolog_config_encoding_mismatch=Page-encoding specified in XML prolog [{0}] is different from that specified in jsp-property-group [{1}] -jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute directive in tag file, attribute [{0}] does not accept any expressions -jsp.error.attribute.standard.non_rt_with_expr=The [{0}] attribute of the [{1}] standard action does not accept any expressions -jsp.error.attribute.deferredmix=Cannot use both ${} and #{} EL expressions in the same attribute value -jsp.error.scripting.variable.missing_name=Unable to determine scripting variable name from attribute [{0}] -jasper.error.emptybodycontent.nonempty=According to TLD, tag [{0}] must be empty, but is not -jsp.error.tagfile.nameNotUnique=The value of [{0}] and the value of [{1}] in line [{2}] are the same. -jsp.error.tagfile.nameFrom.noAttribute=Cannot find an attribute directive with a name attribute with a value [{0}], the value of this name-from-attribute attribute. -jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in line [{1}] and whose name attribute is [{0}], the value of this name-from-attribute attribute) must be of type java.lang.String, is "required" and not a "rtexprvalue". -jsp.error.page.noSession=Cannot access session scope in page that does not participate in any session -jsp.error.usebean.noSession=Illegal for useBean to use session scope when JSP page declares (via page directive) that it does not participate in sessions -jsp.error.xml.encodingByteOrderUnsupported = Given byte order for encoding [{0}] is not supported. -jsp.error.xml.encodingDeclInvalid = Invalid encoding name [{0}]. -jsp.error.xml.encodingDeclRequired = The encoding declaration is required in the text declaration. -jsp.error.xml.morePseudoAttributes = more pseudo attributes is expected. -jsp.error.xml.noMorePseudoAttributes = no more pseudo attributes is allowed. -jsp.error.xml.versionInfoRequired = The version is required in the XML declaration. -jsp.error.xml.xmlDeclUnterminated = The XML declaration must end with "?>". -jsp.error.xml.reservedPITarget = The processing instruction target matching "[xX][mM][lL]" is not allowed. -jsp.error.xml.spaceRequiredInPI = White space is required between the processing instruction target and data. -jsp.error.xml.invalidCharInContent = An invalid XML character (Unicode: 0x[{0}]) was found in the element content of the document. -jsp.error.xml.spaceRequiredBeforeStandalone = White space is required before the encoding pseudo attribute in the XML declaration. -jsp.error.xml.sdDeclInvalid = The standalone document declaration value must be "yes" or "no", not [{0}]. -jsp.error.xml.invalidCharInPI = An invalid XML character (Unicode: 0x[{0}]) was found in the processing instruction. -jsp.error.xml.versionNotSupported = XML version [{0}] is not supported, only XML 1.0 is supported. -jsp.error.xml.pseudoAttrNameExpected = a pseudo attribute name is expected. -jsp.error.xml.expectedByte = Expected byte [{0}] of [{1}]-byte UTF-8 sequence. -jsp.error.xml.invalidByte = Invalid byte [{0}] of [{1}]-byte UTF-8 sequence. -jsp.error.xml.operationNotSupported = Operation [{0}] not supported by [{1}] reader. -jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence must not exceed 0x10 but found 0x[{0}]. -jsp.error.xml.invalidASCII = Byte [{0}] not 7-bit ASCII. -jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl = White space is required before the encoding pseudo attribute in the XML declaration. -jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl = White space is required before the encoding pseudo attribute in the text declaration. -jsp.error.xml.spaceRequiredBeforeVersionInTextDecl = White space is required before the version pseudo attribute in the text declaration. -jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl = White space is required before the version pseudo attribute in the XML declaration. -jsp.error.xml.eqRequiredInXMLDecl = The '' = '' character must follow [{0}] in the XML declaration. -jsp.error.xml.eqRequiredInTextDecl = The '' = '' character must follow [{0}] in the text declaration. -jsp.error.xml.quoteRequiredInTextDecl = The value following [{0}] in the text declaration must be a quoted string. -jsp.error.xml.quoteRequiredInXMLDecl = The value following [{0}] in the XML declaration must be a quoted string. -jsp.error.xml.invalidCharInTextDecl = An invalid XML character (Unicode: 0x[{0}]) was found in the text declaration. -jsp.error.xml.invalidCharInXMLDecl = An invalid XML character (Unicode: 0x[{0}]) was found in the XML declaration. -jsp.error.xml.closeQuoteMissingInTextDecl = closing quote in the value following [{0}] in the text declaration is missing. -jsp.error.xml.closeQuoteMissingInXMLDecl = closing quote in the value following [{0}] in the XML declaration is missing. -jsp.error.multiple.jsp = Cannot have multiple specifications of -jsp.error.jspoutput.conflict=<jsp:output>: illegal to have multiple occurrences of [{0}] with different values (old: [{1}], new: [{2}]) -jsp.error.jspoutput.doctypenamesystem=<jsp:output>: 'doctype-root-element' and 'doctype-system' attributes must appear together -jsp.error.jspoutput.doctypepublicsystem=<jsp:output>: 'doctype-system' attribute must appear if 'doctype-public' attribute appears -jsp.error.jspoutput.nonemptybody=<jsp:output> must not have a body -jsp.error.jspoutput.invalidUse=<jsp:output> must not be used in standard syntax -jsp.error.attributes.not.allowed = [{0}] must not have any attributes -jsp.error.tagfile.badSuffix=Missing ".tag" suffix in tag file path [{0}] -jsp.error.tagfile.illegalPath=Illegal tag file path: [{0}], must start with "/WEB-INF/tags" or "/META-INF/tags" -jsp.error.tagfile.missingPath=Path not specified to tag file -jsp.error.plugin.wrongRootElement=Name of root element in [{0}] different from [{1}] -jsp.error.attribute.invalidPrefix=The attribute prefix [{0}] does not correspond to any imported tag library -jsp.error.nested.jspattribute=A jsp:attribute standard action cannot be nested within another jsp:attribute standard action -jsp.error.nested.jspbody=A jsp:body standard action cannot be nested within another jsp:body or jsp:attribute standard action -jsp.error.variable.either.name=Either name-given or name-from-attribute attribute must be specified in a variable directive -jsp.error.variable.both.name=Cannot specify both name-given or name-from-attribute attributes in a variable directive -jsp.error.variable.alias=Both or none of the name-from-attribute and alias attributes must be specified in a variable directive -jsp.error.attribute.null_name=Null attribute name -jsp.error.jsptext.badcontent='<', when appears in the body of <jsp:text>, must be encapsulated within a CDATA -jsp.error.jsproot.version.invalid=Invalid version number: [{0}], must be "1.2", "2.0", "2.1", "2.2" or "2.3" -jsp.error.noFunction=The function [{0}] cannot be located with the specified prefix -jsp.error.noFunctionMethod=Method [{0}] for function [{1}] not found in class [{2}] -jsp.error.function.classnotfound=The class [{0}] specified in TLD for the function [{1}] cannot be found: [{2}] -jsp.error.signature.classnotfound=The class [{0}] specified in the method signature in TLD for the function [{1}] cannot be found. [{2}] -jsp.error.text.has_subelement=<jsp:text> must not have any subelements -jsp.error.data.file.read=Error reading file [{0}] -jsp.error.data.file.processing=Error processing file [{0}] -jsp.error.prefix.refined=Attempt to redefine the prefix [{0}] to [{1}], when it was already defined as [{2}] in the current scope. -jsp.error.nested_jsproot=Nested <jsp:root> -jsp.error.unbalanced.endtag=The end tag "</{0}" is unbalanced -jsp.error.invalid.bean=The value for the useBean class attribute [{0}] is invalid. -jsp.error.prefix.use_before_dcl=The prefix [{0}] specified in this tag directive has been previously used by an action in file [{1}] line [{2}]. -jsp.error.lastModified=Unable to determine last modified date for file [{0}] -jsp.error.setLastModified=Unable to set last modified date for file [{0}] -jsp.info.ignoreSetting=Ignored setting for [{0}] of [{1}] because a SecurityManager was enabled - -jsp.exception=An exception occurred processing [{0}] at line [{1}] - -# JSP 2.1 -jsp.error.el.template.deferred=#{...} is not allowed in template text -jsp.error.el.parse=[{0}] : [{1}] -jsp.error.page.invalid.deferredsyntaxallowedasliteral=Page directive: invalid value for deferredSyntaxAllowedAsLiteral -jsp.error.tag.invalid.deferredsyntaxallowedasliteral=Tag directive: invalid value for deferredSyntaxAllowedAsLiteral -jsp.error.page.conflict.deferredsyntaxallowedasliteral=Page directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: [{0}], new: [{1}]) -jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: [{0}], new: [{1}]) - -jsp.error.page.invalid.trimdirectivewhitespaces=Page directive: invalid value for trimDirectiveWhitespaces -jsp.error.tag.invalid.trimdirectivewhitespaces=Tag directive: invalid value for trimDirectiveWhitespaces -jsp.error.page.conflict.trimdirectivewhitespaces=Page directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: [{0}], new: [{1}]) -jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: [{0}], new: [{1}]) - -# JSP Servlet -jsp.error.servlet.invalid.method=JSPs only permit GET, POST or HEAD. Jasper also permits OPTIONS -jsp.error.servlet.destroy.failed=Exception during Servlet.destroy() for JSP page - -# JarScanner -jsp.warning.noJarScanner=Warning: No org.apache.tomcat.JarScanner set in ServletContext. Falling back to default JarScanner implementation. - -# JavacErrorDetail -jsp.error.bug48498=Unable to display JSP extract. Probably due to an XML parser bug (see Tomcat bug 48498 for details). - -# UniqueAttributesImpl -jsp.error.duplicateqname=An attribute with duplicate qualified name [{0}] was found. Attribute qualified names must be unique within an element. - -# JSP unloading handling -jsp.message.jsp_queue_created=Created jsp queue with length [{0}] for context [{1}] -jsp.message.jsp_added=Adding JSP for path [{0}] to queue of context [{1}] -jsp.message.jsp_queue_update=Updating JSP for path [{0}] in queue of context [{1}] -jsp.message.jsp_removed_excess=Removing excess JSP for path [{0}] from queue of context [{1}] -jsp.message.jsp_removed_idle=Removing idle JSP for path [{0}] in context [{1}] after [{2}] seconds"); -jsp.message.jsp_unload_check=Checking JSPs for unload in context [{0}], JSP count: [{1}] queue length: [{2}] - -xmlParser.skipBomFail=Failed to skip BOM when parsing XML input stream - -jsp.tldCache.noTldInResourcePath=No TLD files were found in resource path [{0}]. -jsp.tldCache.tldInResourcePath=TLD files were found in resource path [{0}]. -jsp.tldCache.noTldInDir=No TLD files were found in directory [{0}]. -jsp.tldCache.tldInDir=TLD files were found in directory [{0}]. -jsp.tldCache.noTldInJar=No TLD files were found in [{0}]. Consider adding the JAR to the tomcat.util.scan.StandardJarScanFilter.jarsToSkip property in CATALINA_BASE/conf/catalina.properties file. -jsp.tldCache.tldInJar=TLD files were found in JAR [{0}]. -jsp.tldCache.noTldSummary=At least one JAR was scanned for TLDs yet contained no TLDs. Enable debug logging for this logger for a complete list of JARs that were scanned but no TLDs were found in them. Skipping unneeded JARs during scanning can improve startup time and JSP compilation time. - -#ELInterpreter -jsp.error.el_interpreter_class.instantiation=Failed to load or instantiate ELInterpreter class [{0}] +jspc.webxml.footer=\n\ +</web-app>\n\ +\n +jspc.webxml.header=<?xml version="1.0" encoding="{0}"?>\n\ +<web-app xmlns="http://xmlns.jcp.org/xml/ns/javaee"\n\ +\ xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"\n\ +\ xsi:schemaLocation="http://xmlns.jcp.org/xml/ns/javaee\n\ +\ http://xmlns.jcp.org/xml/ns/javaee/web-app_4_0.xsd"\n\ +\ version="4.0"\n\ +\ metadata-complete="false">\n\ +<!--\n\ +Automatically created by Apache Tomcat JspC.\n\ +-->\n\ +\n org.apache.jasper.compiler.ELParser.invalidQuotesForStringLiteral=The String literal [{0}] is not valid. It must be contained within single or double quotes. -org.apache.jasper.compiler.ELParser.invalidQuoting=The expression [{0}] is not valid. Within a quoted String only [\\], [''] and ["] may be escaped with [\\]. - +org.apache.jasper.compiler.ELParser.invalidQuoting=The expression [{0}] is not valid. Within a quoted String only [], [''] and ["] may be escaped with []. org.apache.jasper.compiler.TldCache.servletContextNull=The provided ServletContext was null - org.apache.jasper.servlet.JasperInitializer.onStartup=Initializing Jasper for context [{0}] -org.apache.jasper.servlet.TldScanner.webxmlSkip=Skipping load of TLD for URI [{1}] from resource path [{0}] as it has already been defined in <jsp-config> org.apache.jasper.servlet.TldScanner.webxmlAdd=Loading TLD for URI [{1}] from resource path [{0}] org.apache.jasper.servlet.TldScanner.webxmlFailPathDoesNotExist=Failed to process TLD with path [{0}] and URI [{1}]. The specified path does not exist. +org.apache.jasper.servlet.TldScanner.webxmlSkip=Skipping load of TLD for URI [{1}] from resource path [{0}] as it has already been defined in <jsp-config> + +xmlParser.skipBomFail=Failed to skip BOM when parsing XML input stream
Modified: tomcat/trunk/java/org/apache/naming/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/naming/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/naming/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/naming/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -13,16 +13,18 @@ # See the License for the specific language governing permissions and # limitations under the License. -contextBindings.unknownContext=Unknown context name : [{0}] -contextBindings.noContextBoundToThread=No naming context bound to this thread contextBindings.noContextBoundToCL=No naming context bound to this class loader -selectorContext.noJavaUrl=This context must be accessed through a java: URL -selectorContext.methodUsingName=Call to method [{0}] with a Name of [{1}] -selectorContext.methodUsingString=Call to method [{0}] with a String of [{1}] +contextBindings.noContextBoundToThread=No naming context bound to this thread +contextBindings.unknownContext=Unknown context name : [{0}] + +namingContext.alreadyBound=Name [{0}] is already bound in this Context namingContext.contextExpected=Name is not bound to a Context namingContext.failResolvingReference=Unexpected exception resolving reference -namingContext.nameNotBound=Name [{0}] is not bound in this Context. Unable to find [{1}]. -namingContext.readOnly=Context is read only namingContext.invalidName=Name is not valid -namingContext.alreadyBound=Name [{0}] is already bound in this Context +namingContext.nameNotBound=Name [{0}] is not bound in this Context. Unable to find [{1}]. namingContext.noAbsoluteName=Cannot generate an absolute name for this namespace +namingContext.readOnly=Context is read only + +selectorContext.methodUsingName=Call to method [{0}] with a Name of [{1}] +selectorContext.methodUsingString=Call to method [{0}] with a String of [{1}] +selectorContext.noJavaUrl=This context must be accessed through a java: URL Modified: tomcat/trunk/java/org/apache/naming/factory/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/naming/factory/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/naming/factory/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/naming/factory/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -20,4 +20,4 @@ lookupFactory.typeMismatch=The JNDI refe resourceLinkFactory.nullType=The local resource link [{0}] that refers to global resource [{1}] does not specify the required attribute type resourceLinkFactory.unknownType=The local resource link [{0}] that refers to global resource [{1}] specified the unknown type [{2}] -resourceLinkFactory.wrongType=The local resource link [{0}] that refers to global resource [{1}] was expected to return an instance of [{2}] but returned an instance of [{3}] \ No newline at end of file +resourceLinkFactory.wrongType=The local resource link [{0}] that refers to global resource [{1}] was expected to return an instance of [{2}] but returned an instance of [{3}] Modified: tomcat/trunk/java/org/apache/tomcat/dbcp/dbcp2/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/dbcp/dbcp2/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/dbcp/dbcp2/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/dbcp/dbcp2/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -15,12 +15,12 @@ connectionFactory.lifetimeExceeded=The lifetime of the connection [{0}] milliseconds exceeds the maximum permitted value of [{1}] milliseconds -poolableConnectionFactory.validateObject.fail=Failed to validate a poolable connection. +pool.close.fail=Cannot close connection pool. poolableConnection.validate.fastFail=Fatal SQLException was thrown previously on this connection. -swallowedExceptionLogger.onSwallowedException=An internal object pool swallowed an Exception. +poolableConnectionFactory.validateObject.fail=Failed to validate a poolable connection. poolingDataSource.factoryConfig=PoolableConnectionFactory not linked to pool. Calling setPool() to fix the configuration. -pool.close.fail=Cannot close connection pool. +swallowedExceptionLogger.onSwallowedException=An internal object pool swallowed an Exception. Modified: tomcat/trunk/java/org/apache/tomcat/util/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/util/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/util/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/util/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -14,7 +14,6 @@ # limitations under the License. diagnostics.threadDumpTitle=Full thread dump - diagnostics.vmInfoClassCompilation=Class compilation diagnostics.vmInfoClassLoading=Class loading diagnostics.vmInfoGarbageCollectors=Garbage Collector [{0}] Modified: tomcat/trunk/java/org/apache/tomcat/util/buf/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/util/buf/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/util/buf/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/util/buf/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -14,13 +14,14 @@ # limitations under the License. b2cConverter.unknownEncoding=The character encoding [{0}] is not supported + +byteBufferUtils.cleaner=Cannot use direct ByteBuffer cleaner, memory leaking may occur + c2bConverter.recycleFailed=Failed to recycle the C2B Converter. Creating new BufferedWriter, WriteConvertor and IntermediateOutputStream. -hexUtils.fromHex.oddDigits=The input must consist of an even number of hex digits hexUtils.fromHex.nonHex=The input must consist only of hex digits +hexUtils.fromHex.oddDigits=The input must consist of an even number of hex digits +uDecoder.convertHexDigit.notHex=[{0}] is not a hexadecimal digit uDecoder.urlDecode.conversionError=Failed to decode [{0}] using character set [{1}] uDecoder.urlDecode.missingDigit=Failed to decode [{0}] because the % character must be followed by two hexademical digits -uDecoder.convertHexDigit.notHex=[{0}] is not a hexadecimal digit - -byteBufferUtils.cleaner=Cannot use direct ByteBuffer cleaner, memory leaking may occur Modified: tomcat/trunk/java/org/apache/tomcat/util/compat/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/util/compat/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/util/compat/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/util/compat/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -13,7 +13,7 @@ # See the License for the specific language governing permissions and # limitations under the License. -jreCompat.noApplicationProtocols=Java Runtime does not support SSLParameters.setApplicationProtocols(). You must use Java 9 to use this feature. -jreCompat.noApplicationProtocol=Java Runtime does not support SSLEngine.getApplicationProtocol(). You must use Java 9 to use this feature. - jre9Compat.invalidModuleUri=The module URI provided [{0}] could not be converted to a URL for the JarScanner to process + +jreCompat.noApplicationProtocol=Java Runtime does not support SSLEngine.getApplicationProtocol(). You must use Java 9 to use this feature. +jreCompat.noApplicationProtocols=Java Runtime does not support SSLParameters.setApplicationProtocols(). You must use Java 9 to use this feature. Modified: tomcat/trunk/java/org/apache/tomcat/util/descriptor/tld/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/util/descriptor/tld/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/util/descriptor/tld/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/util/descriptor/tld/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -13,4 +13,4 @@ # See the License for the specific language governing permissions and # limitations under the License. -implicitTldRule.elementNotAllowed=The element [{0}] is not permitted in an implicit.tld file \ No newline at end of file +implicitTldRule.elementNotAllowed=The element [{0}] is not permitted in an implicit.tld file Modified: tomcat/trunk/java/org/apache/tomcat/util/descriptor/web/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/util/descriptor/web/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/util/descriptor/web/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/util/descriptor/web/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -38,24 +38,24 @@ webXml.duplicateResourceEnvRef=Duplicate webXml.duplicateResourceRef=Duplicate resource-ref name [{0}] webXml.duplicateServletMapping=The servlets named [{0}] and [{1}] are both mapped to the url-pattern [{2}] which is not permitted webXml.duplicateTaglibUri=Duplicate tag library URI [{0}] -webXml.reservedName=A web.xml file was detected using a reserved name [{0}]. The name element will be ignored for this fragment. webXml.mergeConflictDisplayName=The display name was defined in multiple fragments with different values including fragment with name [{0}] located at [{1}] webXml.mergeConflictFilter=The Filter [{0}] was defined inconsistently in multiple fragments including fragment with name [{1}] located at [{2}] webXml.mergeConflictLoginConfig=A LoginConfig was defined inconsistently in multiple fragments including fragment with name [{0}] located at [{1}] webXml.mergeConflictOrder=Fragment relative ordering contains circular references. This can be resolved by using absolute ordering in web.xml. webXml.mergeConflictResource=The Resource [{0}] was defined inconsistently in multiple fragments including fragment with name [{1}] located at [{2}] webXml.mergeConflictServlet=The Servlet [{0}] was defined inconsistently in multiple fragments including fragment with name [{1}] located at [{2}] -webXml.mergeConflictSessionCookieName=The session cookie name was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] -webXml.mergeConflictSessionCookieDomain=The session cookie domain was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] -webXml.mergeConflictSessionCookiePath=The session cookie path was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] webXml.mergeConflictSessionCookieComment=The session cookie comment was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] +webXml.mergeConflictSessionCookieDomain=The session cookie domain was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] webXml.mergeConflictSessionCookieHttpOnly=The session cookie http-only flag was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] -webXml.mergeConflictSessionCookieSecure=The session cookie secure flag was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] webXml.mergeConflictSessionCookieMaxAge=The session cookie max-age was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] +webXml.mergeConflictSessionCookieName=The session cookie name was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] +webXml.mergeConflictSessionCookiePath=The session cookie path was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] +webXml.mergeConflictSessionCookieSecure=The session cookie secure flag was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] webXml.mergeConflictSessionTimeout=The session timeout was defined inconsistently in multiple fragments with different values including fragment with name [{0}] located at [{1}] webXml.mergeConflictSessionTrackingMode=The session tracking modes were defined inconsistently in multiple fragments including fragment with name [{0}] located at [{1}] webXml.mergeConflictString=The [{0}] with name [{1}] was defined inconsistently in multiple fragments including fragment with name [{2}] located at [{3}] webXml.multipleOther=Multiple others entries in ordering +webXml.reservedName=A web.xml file was detected using a reserved name [{0}]. The name element will be ignored for this fragment. webXml.unrecognisedPublicId=The public ID [{0}] did not match any of the known public ID''s for web.xml files so the version could not be identified webXml.version.unknown=Unknown version string [{0}]. Default version will be used. webXml.wrongFragmentName=Used a wrong fragment name [{0}] at web.xml absolute-ordering tag! Modified: tomcat/trunk/java/org/apache/tomcat/util/file/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/util/file/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/util/file/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/util/file/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -13,4 +13,4 @@ # See the License for the specific language governing permissions and # limitations under the License. -configFileLoader.noConfigurationSource=No configuration source has been set using ConfigFileLoader.setSource. \ No newline at end of file +configFileLoader.noConfigurationSource=No configuration source has been set using ConfigFileLoader.setSource. Modified: tomcat/trunk/java/org/apache/tomcat/util/http/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/util/http/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/util/http/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/util/http/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -13,25 +13,28 @@ # See the License for the specific language governing permissions and # limitations under the License. +cookies.fallToDebug=\n\ +\ Note: further occurrences of Cookie errors will be logged at DEBUG level. +cookies.invalidCookieToken=Cookies: Invalid cookie. Value not a token or quoted value +cookies.invalidSpecial=Cookies: Unknown Special Cookie +cookies.maxCountFail=More than the maximum allowed number of cookies, [{0}], were detected. + +headers.maxCountFail=More than the maximum allowed number of headers, [{0}], were detected. + parameters.bytes=Start processing with input [{0}] parameters.copyFail=Failed to create copy of original parameter values for debug logging purposes parameters.decodeFail.debug=Character decoding failed. Parameter [{0}] with value [{1}] has been ignored. parameters.decodeFail.info=Character decoding failed. Parameter [{0}] with value [{1}] has been ignored. Note that the name and value quoted here may be corrupted due to the failed decoding. Use debug level logging to see the original, non-corrupted values. parameters.emptyChunk=Empty parameter chunk ignored +parameters.fallToDebug=\n\ +\ Note: further occurrences of Parameter errors will be logged at DEBUG level. parameters.invalidChunk=Invalid chunk starting at byte [{0}] and ending at byte [{1}] with a value of [{2}] ignored parameters.maxCountFail=More than the maximum number of request parameters (GET plus POST) for a single request ([{0}]) were detected. Any parameters beyond this limit have been ignored. To change this limit, set the maxParameterCount attribute on the Connector. -parameters.maxCountFail.fallToDebug=\n Note: further occurrences of this error will be logged at DEBUG level. +parameters.maxCountFail.fallToDebug=\n\ +\ Note: further occurrences of this error will be logged at DEBUG level. parameters.multipleDecodingFail=Character decoding failed. A total of [{0}] failures were detected but only the first was logged. Enable debug level logging for this logger to log all failures. parameters.noequal=Parameter starting at position [{0}] and ending at position [{1}] with a value of [{0}] was not followed by an ''='' character -parameters.fallToDebug=\n Note: further occurrences of Parameter errors will be logged at DEBUG level. - -cookies.invalidCookieToken=Cookies: Invalid cookie. Value not a token or quoted value -cookies.invalidSpecial=Cookies: Unknown Special Cookie -cookies.fallToDebug=\n Note: further occurrences of Cookie errors will be logged at DEBUG level. -cookies.maxCountFail=More than the maximum allowed number of cookies, [{0}], were detected. - -headers.maxCountFail=More than the maximum allowed number of headers, [{0}], were detected. rfc6265CookieProcessor.invalidCharInValue=An invalid character [{0}] was present in the Cookie value rfc6265CookieProcessor.invalidDomain=An invalid domain [{0}] was specified for this cookie -rfc6265CookieProcessor.invalidPath=An invalid path [{0}] was specified for this cookie \ No newline at end of file +rfc6265CookieProcessor.invalidPath=An invalid path [{0}] was specified for this cookie Modified: tomcat/trunk/java/org/apache/tomcat/util/http/parser/LocalStrings.properties URL: http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/tomcat/util/http/parser/LocalStrings.properties?rev=1846398&r1=1846397&r2=1846398&view=diff ============================================================================== --- tomcat/trunk/java/org/apache/tomcat/util/http/parser/LocalStrings.properties [UTF-8] (original) +++ tomcat/trunk/java/org/apache/tomcat/util/http/parser/LocalStrings.properties [UTF-8] Mon Nov 12 11:16:39 2018 @@ -37,4 +37,4 @@ http.tooFewHextets=An IPv6 address must http.tooManyColons=An IPv6 address may not contain more than 2 sequential colon characters. http.tooManyDoubleColons=An IPv6 address may only contain a single '::' sequence. http.tooManyHextets=The IPv6 address contains [{0}] hextets but a valid IPv6 address may not have more than 8. -http.wrongOctetCount=An IPv4 address should have exactly 4 octets, not [{0}]. \ No newline at end of file +http.wrongOctetCount=An IPv4 address should have exactly 4 octets, not [{0}]. --------------------------------------------------------------------- To unsubscribe, e-mail: [email protected] For additional commands, e-mail: [email protected]
