This particular interface is described at http://www.cbs.dtu.dk/ws/ ws.php?entry=SignalP The namespace is described in http://www.cbs.dtu.dk/ws/SignalP/ws_signalp_3_1.xsd http://www.cbs.dtu.dk/ws/common/ws_common_1_0.xsd
There is an example python SOAP script http://www.cbs.dtu.dk/ws/SignalP/examples/signalP.py The input could be the string as the sequences >seq1 ASTPGHTIIYEAVCLHNDRTTIP >seq2 optional comment ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES Parameters: organism = gram+ method=nn+hmm In the end, there would also need to be a method to parse the fetchResultResponse type You can see comparable results by running the same sequence the web page at http://www.cbs.dtu.dk/services/SignalP/ Kyle > Hi Kyle, > > I'm working on a new web service actor that can send and receive > complex data types. > The SignalP service would be a good test; can you give me some > example inputs and > expected outputs for using 'runService'? > > Thanks, > --dan > > Kyle Ellrott wrote: >> I'm new to Kepler, so I'm still getting used to how things work. >> I'm making a small test workflow that takes an amino acid >> sequence and runs it on a SignalP soap server, described at >> http:// www.cbs.dtu.dk/ws/SignalP/SignalP_3_1.wsdl >> The example included with Kepler, 06- >> WebServicesAndDataTransformation.xml, the service uses a standard >> string as input. SignalP uses a complex type 'runService' >> described in http://www.cbs.dtu.dk/ws/SignalP/ws_signalp_3_1.xsd >> and http:// www.cbs.dtu.dk/ws//common/ws_common_1_0.xsd >> Basically I need to take an input string and an id, pack it into >> the complex 'sequences', pack that into a 'runService', with >> some parameters, and then use that as input to the web server actor. >> Are there some default actors that can take several individual >> types and pack them into a complex type? Does anybody have any >> examples of how to do this sort of thing? >> >> Thanks, >> Kyle Ellrott >> _______________________________________________ >> Kepler-users mailing list >> Kepler-users at ecoinformatics.org >> http://mercury.nceas.ucsb.edu/ecoinformatics/mailman/listinfo/ >> kepler-users >> >
