Sevgili Arkadaslar, Asagida verdigim belgenin icinde bulunan iki farkli bilgileri tek satir seklinde gostermek istiyorum.
1. ornek belge [belgenin adi: c3ngv3_sulin : >sp|C3NGV3|VATD_SULIN V-type ATP synthase subunit D OS=Sulfolobus islandicus >(strain Y.N.15.51 / Yellowstone #2) OX=419942 GN=atpD PE=3 SV=1 MSQKVLPTKINLIQFRRQLRLITVIKRLLENKREVLLLYLRTYASEYEKIYNEVNEEMKK VYESYLQAVASEGISNIEEIALSQKPSLEVSSSIKVIFGVKVPTIKLDKSTIPSKPFSDV ETSPYLSESYEEMTEAFNKIIELVELESTIRSLVSELRKTQRLINSIDNYILPFYRGSIK FIKQILEDRQREEFSRLKIIRRILQRRRESGSG 2. kullandigim komut: bash-4.3$ cat c3ngv3_sulin | sed -e 's/\(^>.*$\)/#\1#/' -e 'H;${z;x;s/\n//g;p;};/0$/!d;x;s/\n\r//g;'|sed -e 's/\#/\n/g' 3. aldigim sonuc: >sp|C3NGV3|VATD_SULIN V-type ATP synthase subunit D OS=Sulfolobus islandicus >(strain Y.N.15.51 / Yellowstone 2) OX=419942 GN=atpD PE=3 SV=1 MSQKVLPTKINLIQFRRQLRLITVIKRLLENKREVLLLYLRTYASEYEKIYNEVNEEMKKVYESYLQAVASEGISNIEEIALSQKPSLEVSSSIKVIFGVKVPTIKLDKSTIPSKPFSDVETSPYLSESYEEMTEAFNKIIELVELESTIRSLVSELRKTQRLINSIDNYILPFYRGSIKFIKQILEDRQREEFSRLKIIRRILQRRRESGSG 4. sorun: >sp ile baslayan satir, her zaman "tek satir" olmali [ve onun altinda bulunan ve ">sp" ile baslamayanlar da tek satir seklinde birlesmis olmali, evet, bunda sorun yok..] 4. olmasi gereken [elimle duzeltiyorum]: >sp|C3NGV3|VATD_SULIN V-type ATP synthase subunit D OS=Sulfolobus islandicus >(strain Y.N.15.51 / Yellowstone 2) OX=419942 GN=atpD PE=3 SV=1 MSQKVLPTKINLIQFRRQLRLITVIKRLLENKREVLLLYLRTYASEYEKIYNEVNEEMKKVYESYLQAVASEGISNIEEIALSQKPSLEVSSSIKVIFGVKVPTIKLDKSTIPSKPFSDVETSPYLSESYEEMTEAFNKIIELVELESTIRSLVSELRKTQRLINSIDNYILPFYRGSIKFIKQILEDRQREEFSRLKIIRRILQRRRESGSG Yardim edecek arkadaslara simdiden tesekkur ediyorum. Saygilarimla, -- suleyman say...@anadolu.edu.tr ________________________________ Bu elektronik posta ve onunla iletilen bütün dosyalar sadece yukarıda isimleri belirtilen kişiler arasında özel haberleşme amacını taşımakta olup gönderici tarafından alınması amaçlanan yetkili gerçek ya da tüzel kişinin kullanımına aittir. Eğer bu elektronik posta size yanlışlıkla ulaşmışsa, elektronik postanın içeriğini açıklamanız, kopyalamanız, yönlendirmeniz ve kullanmanız kesinlikle yasaktır. Bu durumda, lütfen mesajı geri gönderiniz ve sisteminizden siliniz. Anadolu Üniversitesi bu mesajın içerdiği bilgilerin doğruluğu veya eksiksiz olduğu konusunda herhangi bir garanti vermemektedir. Bu nedenle bu bilgilerin ne şekilde olursa olsun içeriğinden, iletilmesinden, alınmasından ve saklanmasından sorumlu değildir. Bu mesajdaki görüşler yalnızca gönderen kişiye aittir ve Anadolu Üniversitesinin görüşlerini yansıtmayabilir. This electronic mail and any files transmitted with it are intended for the private use of the people named above. If you are not the intended recipient and received this message in error, forwarding, copying or use of any of the information is strictly prohibited. Any dissemination or use of this information by a person other than the intended recipient is unauthorized and may be illegal. In this case, please immediately notify the sender and delete it from your system. Anadolu University does not guarantee the accuracy or completeness of any information included in this message. Therefore, by any means Anadolu University is not responsible for the content of the message, and the transmission, reception, storage, and use of the information. The opinions expressed in this message only belong to the sender of it and may not reflect the opinions of Anadolu University. _______________________________________________ Linux E-Posta Listesi Linux@liste.linux.org.tr Liste kurallari: http://liste.linux.org.tr/kurallar.php Bu Listede neden bulunduğunuzu bilmiyorsanız veya artık bu listeden gelen e-postaları almak istemiyorsanız aşağıdaki bağlantı adresini kullanarak 1 dakika içinde üyeliğinizi sonlandırabilirsiniz. https://liste.linux.org.tr/mailman/listinfo/linux