Sevgili Arkadaslar,
Asagida verdigim belgenin icinde bulunan iki farkli bilgileri tek satir
seklinde gostermek istiyorum.
1. ornek belge [belgenin adi: c3ngv3_sulin :
>sp|C3NGV3|VATD_SULIN V-type ATP synthase subunit D OS=Sulfolobus islandicus
>(strain Y.N.15.51 / Yellowstone #2) OX=419942 GN=atpD PE=3 SV=1
MSQKVLPTKINLIQFRRQLRLITVIKRLLENKREVLLLYLRTYASEYEKIYNEVNEEMKK
VYESYLQAVASEGISNIEEIALSQKPSLEVSSSIKVIFGVKVPTIKLDKSTIPSKPFSDV
ETSPYLSESYEEMTEAFNKIIELVELESTIRSLVSELRKTQRLINSIDNYILPFYRGSIK
FIKQILEDRQREEFSRLKIIRRILQRRRESGSG
2. kullandigim komut:
bash-4.3$ cat c3ngv3_sulin | sed -e 's/\(^>.*$\)/#\1#/' -e
'H;${z;x;s/\n//g;p;};/0$/!d;x;s/\n\r//g;'|sed -e 's/\#/\n/g'
3. aldigim sonuc:
>sp|C3NGV3|VATD_SULIN V-type ATP synthase subunit D OS=Sulfolobus islandicus
>(strain Y.N.15.51 / Yellowstone
2) OX=419942 GN=atpD PE=3 SV=1
MSQKVLPTKINLIQFRRQLRLITVIKRLLENKREVLLLYLRTYASEYEKIYNEVNEEMKKVYESYLQAVASEGISNIEEIALSQKPSLEVSSSIKVIFGVKVPTIKLDKSTIPSKPFSDVETSPYLSESYEEMTEAFNKIIELVELESTIRSLVSELRKTQRLINSIDNYILPFYRGSIKFIKQILEDRQREEFSRLKIIRRILQRRRESGSG
4. sorun: >sp ile baslayan satir, her zaman "tek satir" olmali [ve onun altinda
bulunan ve ">sp" ile baslamayanlar da tek satir seklinde birlesmis olmali,
evet, bunda sorun yok..]
4. olmasi gereken [elimle duzeltiyorum]:
>sp|C3NGV3|VATD_SULIN V-type ATP synthase subunit D OS=Sulfolobus islandicus
>(strain Y.N.15.51 / Yellowstone 2) OX=419942 GN=atpD PE=3 SV=1
MSQKVLPTKINLIQFRRQLRLITVIKRLLENKREVLLLYLRTYASEYEKIYNEVNEEMKKVYESYLQAVASEGISNIEEIALSQKPSLEVSSSIKVIFGVKVPTIKLDKSTIPSKPFSDVETSPYLSESYEEMTEAFNKIIELVELESTIRSLVSELRKTQRLINSIDNYILPFYRGSIKFIKQILEDRQREEFSRLKIIRRILQRRRESGSG
Yardim edecek arkadaslara simdiden tesekkur ediyorum.
Saygilarimla,
-- suleyman
say...@anadolu.edu.tr
________________________________
Bu elektronik posta ve onunla iletilen bütün dosyalar sadece yukarıda isimleri
belirtilen kişiler arasında özel haberleşme amacını taşımakta olup gönderici
tarafından alınması amaçlanan yetkili gerçek ya da tüzel kişinin kullanımına
aittir. Eğer bu elektronik posta size yanlışlıkla ulaşmışsa, elektronik
postanın içeriğini açıklamanız, kopyalamanız, yönlendirmeniz ve kullanmanız
kesinlikle yasaktır. Bu durumda, lütfen mesajı geri gönderiniz ve sisteminizden
siliniz. Anadolu Üniversitesi bu mesajın içerdiği bilgilerin doğruluğu veya
eksiksiz olduğu konusunda herhangi bir garanti vermemektedir. Bu nedenle bu
bilgilerin ne şekilde olursa olsun içeriğinden, iletilmesinden, alınmasından ve
saklanmasından sorumlu değildir. Bu mesajdaki görüşler yalnızca gönderen kişiye
aittir ve Anadolu Üniversitesinin görüşlerini yansıtmayabilir.
This electronic mail and any files transmitted with it are intended for the
private use of the people named above. If you are not the intended recipient
and received this message in error, forwarding, copying or use of any of the
information is strictly prohibited. Any dissemination or use of this
information by a person other than the intended recipient is unauthorized and
may be illegal. In this case, please immediately notify the sender and delete
it from your system. Anadolu University does not guarantee the accuracy or
completeness of any information included in this message. Therefore, by any
means Anadolu University is not responsible for the content of the message, and
the transmission, reception, storage, and use of the information. The opinions
expressed in this message only belong to the sender of it and may not reflect
the opinions of Anadolu University.
_______________________________________________
Linux E-Posta Listesi
Linux@liste.linux.org.tr
Liste kurallari: http://liste.linux.org.tr/kurallar.php
Bu Listede neden bulunduğunuzu bilmiyorsanız veya artık bu listeden gelen
e-postaları almak istemiyorsanız aşağıdaki bağlantı adresini kullanarak 1
dakika içinde üyeliğinizi sonlandırabilirsiniz.
https://liste.linux.org.tr/mailman/listinfo/linux
