Re: Members area
Look at this file with links. They will help a lot.
Jonathan [EMAIL PROTECTED] wrote in message
[EMAIL PROTECTED]">news:[EMAIL PROTECTED]...
I would like to allow members to manage their accounts on-line.
I need a resource that explains each 'security' method, and discusses the
pros and cons of each. Do you know of any books or tutorials that do this?
Or at least provide a list of the different options?
begin 666 CGI Security.htm
M/%$3T-465!%($A434P@4%53$E#((M+R]7,T,O+T141!(5$U,(#0N,!4
MF%NVET:6]N86PO+T5.(CX-CPA+2T@V%V960@9G)O;2!UFP]*# P-#0I
M:'1T#HO+W=W=RYI;7!R;W9I;FN;W)G+W!A=6QP+V-G:2US96-UFET2\@
M+2T^#0H\2%1-3#X\2$5!1#X\5$E43$4^0T=)(%-E8W5R:71Y/]4251,13X-
MCQ-151!(AT=' M97%U:78]0V]N=5N=U47!E(-O;G1E;G0](G1E'0O
M:'1M;#L@8VAAG-E=#UIV\M.#@U.2TQ(CX-CQ-151!(-O;G1E;G0](DU3
M2%1-3 V+C P+C(V,# N,(@;F%M93U'14Y%4D%43U(^/](14%$/@T*/$)/
M1%D^#0H\2#(^0T=)(%-E8W5R:71Y/](,CX\4U123TY'/E=AFYI;FA($)O
M=@@=AIR!L:7-T(%N9!T:4@9]C=6UE;G0@22!WF]T92 -F%R92!Y
M96%RR!O;0@86YD('5N;6%I;G1A:6YE9P@86YD(EN('1H92!S96-UFET
M2!G86UE('1H870GR!A(')E8VEP92!F;W(@#0IU;FAA'!I;F5SRX@4F5L
M2!O;B!T:ES(EN9F]R;6%T:6]N(%T('EO=7(@;W=N(')IVLN($D@;5A
M=F4@=AIR!P86=E('5P( T*;VYL2!B96-A=7-E(ET)W,@F5F97)E;F-E
M9!FF]M('-O(UA;GD@QA8V5S+CPO4U123TY'/@T*/% ^5AIR!D;V-U
M;65N=!G871H97)S(')EV]UF-ER!R96QA=5D('1O('=R:71I;F@V5C
M=7)E($-'22!S8W)I'1S(9OB!75U@#0IS97)V97)S+B \02!HF5F/2)H
M='1P.B\O=W=W+G-T87)S+F-O;2]6;EB+U!R;W9I95RR]#1TDN:'1M;(^
M1V5N97)A; -FEN9F]R;6%T:6]N(]N($-'23PO03X@:7,@')O=FED960@
M96QS97=H97)E+B!4:4@5U=7(%-E8W5R:71Y(1O8W5M96YT()Y( T*3EN
M8V]L;B!3=5I;B!IR!T:4@;6]S=!C;VUPF5H96YS:79E(]F('1H92!L
M:7-T960@F5S;W5R8V5S(%T('1H:7,@=EM92P@#0IA;F0@:70@:%S($@
MW5BW1A;G1I86P@V5C=EO;B!O;B!#1TDN#0H\4#X-CQ53#X-B @/$Q)
M/CQ!(AR968](FAT=' Z+R]W=WN:6UPF]V:6YG+F]R9R]P875L]C9VDM
MV5C=7)I='DOV%F92UC9VDN='AT(CY7FET:6YG( T*(!S869E($-'22!S
M8W)I'1S(TM(%N(]V97)V:65W/]!/B H4%U;!0:EL;EPRD@#0H@
M(#Q,23X\02!HF5F/2)H='1P.B\O=W=W+6=E;F]M92YW:2YM:70N961U+U=7
M5R]F87%S+W=W=RUS96-UFET2UF87$N:'1M;(^5U=7( T*(!396-UFET
M3PO03X@*$QI;F-O;X@4W1E:6XI( T*( \3$D^/$$@:')E9CTB:'1T#HO
M+W=W=RYCV-L=6(N=7=A=5R;]O+F-A+W4O;6QV86YB:64O8V=IV5C+R(^
M0T=)( T*(!396-UFET3PO03X@*$UI8VAA96P@5F%N($)I97-BF]U8VLI
M( T*( \3$D^/$$@:')E9CTB:'1T#HO+VAO;VAO;RYN8W-A+G5I=6,N961U
M+V-G:2TQ+C$OV5C=7)I='DN:'1M;(^3D-302=S('1I',@#0H@(9OB!W
MFET:6YG('-E8W5R92!#1TD@V-R:7!TSPO03X@#0H@(#Q,23X\02!HF5F
M/2)H='1P.B\O=W=W+G!EFPN8V]M+W!EFPO;F5WR]L871R;RUA;FYO=6YC
M92YH=UL(CY,871R;SPO03XL($@#0H@('1O;VP@9F]R(ED96YT:69Y:6YG
M(ENV5C=7)E(%!EFP@0T=)(ENW1A;QA=EO;G,L()Y(%1O;2!#:')I
MW1I86YS96X@#0H@(#Q,23X\02!HF5F/2)H='1P.B\O=W=W+F=T+F5D+FYE
M=]K96ET:]C9VDOV5C=7)I='DN:'1M;(^07)E(%EO=2!3869E/SPO03X@
M#0H@(A+96ET:!'87)D;F5R*2 -B @/$Q)/CQ!(AR968](F9T#HO+V9T
MYC97)T+F]R9R]P=6(O=5C:%]T:7!S+V-G:5]M971A8VAAF%C=5RR(^
M0T525 -B @861V:7-OGD@;VX@0T=)(UE=%C:%R86-T97)S/]!/B -
MB @/$Q)/CQ!(AR968](FAT=' Z+R]W=WN=S,N;W)G+U-E8W5R:71Y+T9A
M2]W=W=S9C0N:'1M;(^5AE(%S0R!#1TD@4V5C=7)I='D@#0H@($9!43PO
M03X@/],23X\+U5,/@T*/% ^268@6]U(MN;W@;V8@;W1H97(@QA8V5S
M(%D9')EW-I;F@0T=)('-E8W5R:71Y('-P96-I9FEC86QL2P@QE87-E
M( T*W5B;6ET('1O(#Q!(AR968](FUA:6QT;SIP875L$!G;S)N970N8V]M
M(CYP875L$!G;S)N970N8V]M/]!/BX@/]0/@T*/$A2/@T*/$5-/G!A=6QP
A0=O,FYE=YC;VT\+T5-/B \+T)/1%D^/](5$U,/@T*
`
end
--
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
Re: my mailbox is filling with all posted messages, what to do?
I would highly recomend you to configure an newsgroup reader like Outlook Express. I use it - it's excellent. This way you can download only the headers of the messages and preview those which look well to you. By the way, are you from Yougoslavia? Here's a neighbor guy. Michal Simovic [EMAIL PROTECTED] wrote in message [EMAIL PROTECTED]">news:[EMAIL PROTECTED]... I'm sorry for bugging you but I don't understand (I'm not a native english speaker) what should I do if I only wish to receive answers to my questions to my mailbox and not all the others that were posted. could somebody explain? thank you __ Do You Yahoo!? Yahoo! Health - Feel better, live better http://health.yahoo.com -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
Re: Hi, newbie question
Hello, I don't think that the file matters. You say it's a massive line. To read a file you should first open it. Look at PerlDoc. Desmond Lee [EMAIL PROTECTED] wrote in message [EMAIL PROTECTED]">news:[EMAIL PROTECTED]... Hi guys I'm trying to read a file, but it's just one massive line. I think that the ^M is suppose to be an indication that that's wehre teh newline is suppose to be. I've tried to replace ^M with a newline by executing something that i found on the web: perl -pi.bak -e 's/\^M/\n/g' moby_threads_install.txt This didn't work. Even in vi when i do a search for ^M by doing '/^M' it says that no matches were found. The ^M is not two characters but one. Can anyone out there please help me? Thanks Desmond _ Send and receive Hotmail on your mobile device: http://mobile.msn.com -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
Re: strange query.
Use double quotes ( ) for surrounding, instead of apostrophy ( ' ). Thus
it will interpret it and not translate it litterally.
--
Best Wishes,
Yasen Petrov
ICQ 163 671 835
James Campbell [EMAIL PROTECTED] wrote in message
[EMAIL PROTECTED]">news:[EMAIL PROTECTED]...
Hi Everyone
I'm having a spot of bother with a query string.
The program below attempts to mimic a web form. It should post the value
of
'QUERY ..' to the cgi in $location.
What is actually happening is that 'QUERY ..' itself is being sent as the
value. I copied the name 'QUERY ..' from the textarea name on the original
web form.
I have tried character escaping the space and the two dots but that didn't
work (the cgi hung).
Maybe I need to use CGI.pm to generate the query string?
Anyone got any ideas?
Thanks
James
--
#!/usr/bin/perl -w
use strict;
use LWP::UserAgent;
use HTTP::Request;
#This is the sequence for analysis (it is actually all on one line!!!)
my Seq='MQMRVLRIQHPLDHRPRHDRKTRHEVMLPDRKTRDLVVAIRNDRRA
LRIGAHIQAMPVFRRVQIERRRGVRRMHVADALLNQLRGLRMQFQRHAERGRR
ALTRVVVRRGADAARGEHDVSRGERAPQRRRDALGVVADVLRPAERQPTRAEQ
FDNLRQMLVDPPARQDLIAAKCHCRLFRLVSNSSVGNRRRVPHAAVLFR
AHALQRAQTV';
#Send the request
my $location = http://www.sbc.su.se/~miklos/DAS/tmdas.cgi;;
my $agent = new LWP::UserAgent;
my $req = new HTTP::Request POST = $location;
$req - header('Accept' = 'text/html');
$req - header('Accept' = 'image/gif');
$req - header('Accept' = 'text/plain');
$req - header('Content-Type' =
'application/x-www-form-urlencoded');
$req - content('QUERY ..' = $seq);
#Receive the response
my $result = $agent-request( $req );
print $result-headers_as_string;
print $result-content;
James Campbell
Tel: +44-(0)207-848-5111
Email: [EMAIL PROTECTED]
=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=
'Where shall I begin, please your Majesty?' He asked
'Begin at the beggining,' the King said gravely, 'and go on
till you come to the end: then stop.'
Lewis Carroll, Alice's Adventures in Wonderland.
--
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
Probably impossible
Hi all, my problem is that I want to send an e-mail every day, but when I try to iterate, the unix perl wants to see all the iterations and then execute them at once, while this isn't the same on windows. This means I can't send an e-mail every day this way below: #!usr/bin/perl use warnings; use CGI::Carp qw(fatalsToBrowser); my $mailprogram = /usr/lib/sendmail; my $rec = '[EMAIL PROTECTED]'; my $i = 0; while ($i 300) open (MAIL,|$mailprogram -t); print MAIL To: $rec\n; print MAIL From: Yasen_Petrov\n; print MAIL Subject: Ads\n; print MAIL Some text\n; sleep 60*60*24; # 24 hours close MAIL; $i++; print Content-type: text/html\n\n; print You have just send an e-mail to $rec\n; } If anyone can help, I'll be very grateful. Thanks. -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
How to Tweek The DOS Prompt
Hi there, Anytime I run the DOS prompt it shows: C:\WINDOWS\Desltop. And I'll have to go all the way to C:\localhost\cgi-bin. Is there a way to make the prompt show straight my cgi-bin? Thanks. -- Best wishes, Yasen Petrov -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
Advanced Users in The Beginners List
Hi there, I think there's too many andvanced users here who ask DBI questions. I can't understand anything. Perl.beginners and perl.beginners.cgi are both too overloaded. Noone can read 80 massages a day, in it? I mean perl.beginners. There should be perl.intermediate as well as perl.advanced. As for the DBI questions, they have to be set in the DBI list. -- Best regards, Yasen Petrov Dear mother country, you are a land paradise. Your beautiness, your fascination are endless... From the national anthem of Bulgaria -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
Is there a PDA for Perl?
Hi all, I'd like to get a Pocket Computer which will run Perl. Is that possible and where to find it. This could safe lot of time, in it? Cheers. Yasen -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
Why could Perl help the PDA enthusiast?
Hello, I've got two questions: 1. How could Perl help the PDA enthusiast? 2. When I turn on my PC, I'm promped to choose a OS: Win98 or WinXP. XP doesn't work. So how to remove this prompt and run always Win98? Thanks -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
