I have noticed renaming chains in the sequence ID's but not in the coordinates:
2FBW_3|Chains C, G[auth P]|Succinate dehydrogenase cytoch
MATTAKEEMARFWEKNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSL
2FBW_4|Chains D, H[auth Q]|Succinate dehydrogenase [ubiqu
GSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLGQVITDY
2FBW_1|Chains A, E[auth N]|Succinate dehydrogenase [ubiqu
STKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTV
2FBW_2|Chains B, F[auth O]|Succinate dehydrogenase [ubiqu
AQTAAAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDST
CHAINS NOPQ (AUTH) are labeled EFGH in the "view FASTA" The coordinates still have the oddball lettering. Which could be confusing. Ed ######################################################################## To unsubscribe from the CCP4BB list, click the following link: https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB&A=1 This message was issued to members of www.jiscmail.ac.uk/CCP4BB, a mailing list hosted by www.jiscmail.ac.uk, terms & conditions are available at https://www.jiscmail.ac.uk/policyandsecurity/
