Processed: closing 837495

2016-09-14 Thread Debian Bug Tracking System
Processing commands for cont...@bugs.debian.org:

> close 837495
Bug #837495 [src:gnome-shell-extension-suspend-button] 
gnome-shell-extension-suspend-button: uninstallable in sid: Depends: 
gnome-shell (< 3.21) but 3.21.91-2 is to be installed
Bug #837592 [src:gnome-shell-extension-suspend-button] 
gnome-shell-extension-suspend-button: Not compatible with gnome-shell 
3.21.x/3.22
Marked Bug as done
Marked Bug as done
> thanks
Stopping processing here.

Please contact me if you need assistance.
-- 
837495: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837495
837592: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837592
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems



Processed: 278271 is fixed upstream and we took that version

2016-09-14 Thread Debian Bug Tracking System
Processing commands for cont...@bugs.debian.org:

> close 278271 1.13.1+dfsg-1
Bug #278271 [krb5] send-pr used tmp files unsafely
There is no source info for the package 'krb5' at version '1.13.1+dfsg-1' with 
architecture ''
Unable to make a source version for version '1.13.1+dfsg-1'
Marked as fixed in versions 1.13.1+dfsg-1.
Bug #278271 [krb5] send-pr used tmp files unsafely
Marked Bug as done
> thanks
Stopping processing here.

Please contact me if you need assistance.
-- 
278271: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=278271
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems



Bug#837761: marked as done (vim: Mouse enabled automatically, central button breaks badly)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 21:12:25 -0400
with message-id <20160915011225.3iaxi3qwgc4qa...@freya.jamessan.com>
and subject line Re: Bug#837761: vim: Mouse enabled automatically, central 
button breaks badly
has caused the Debian Bug report #837761,
regarding vim: Mouse enabled automatically, central button breaks badly
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837761: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837761
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: vim
Version: 2:8.0.0003-1
Severity: normal

Dear Maintainer,
after the last update it seems that the mouse is enabled
automatically, without giving the
set mouse=a
command.

As a consequence, I can no longer copy/paste using the central button
within X terminal emulators.

-- Package-specific info:

--- real paths of main Vim binaries ---
/usr/bin/vi is /usr/bin/vim.basic
/usr/bin/vim is /usr/bin/vim.basic

-- System Information:
Debian Release: stretch/sid
 APT prefers unstable
 APT policy: (500, 'unstable')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.7.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=it_IT.UTF-8, LC_CTYPE=it_IT.UTF-8 (charmap=UTF-8)
(ignored: LC_ALL set to it_IT.UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages vim depends on:
ii  libacl1  2.2.52-3
ii  libc62.24-2
ii  libgpm2  1.20.4-6.2
ii  libselinux1  2.5-3
ii  libtinfo56.0+20160625-1
ii  vim-common   2:8.0.0003-1
ii  vim-runtime  2:8.0.0003-1

vim recommends no packages.

Versions of packages vim suggests:
pn  ctags
pn  vim-doc  
pn  vim-scripts  
--- End Message ---
--- Begin Message ---
On Wed, Sep 14, 2016 at 12:19:00PM +0200, Salvo Tomaselli wrote:
> Dear Maintainer,
> after the last update it seems that the mouse is enabled
> automatically, without giving the
> set mouse=a
> command.

If you don't have your own ~/.vimrc, yes.  These were defaults enabled
by upstream.

> As a consequence, I can no longer copy/paste using the central button
> within X terminal emulators.

You can.  Just hold shift while doing so (to tell the terminal not to
pass the moues on to the app).  Alternatively, configure Vim's
'clipboard' option to have the "autoselect" setting (which it should by
default) so that the Visual selection created by the mouse also asserts
the X selection.

Cheers,
-- 
James
GPG Key: 4096R/91BF BF4D 6956 BD5D F7B7  2D23 DFE6 91AE 331B A3DB--- End Message ---


Bug#837819: marked as done (at-spi2-core: (Future) FTBFS due to undeclared build dependencies)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Thu, 15 Sep 2016 00:03:49 +
with message-id 
and subject line Bug#837819: fixed in at-spi2-core 2.20.2-2
has caused the Debian Bug report #837819,
regarding at-spi2-core: (Future) FTBFS due to undeclared build dependencies
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837819: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837819
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: at-spi2-core
Version: 2.20.2-1
Severity: important
User: pkg-gnome-maintain...@lists.alioth.debian.org
Usertags: gtk-doc-tools

Hi,

your package at-spi2-core declares a build dependency on gtk-doc-tools.
gtk-doc-tools in turn depends on gnome-common, which in turn pulls in packages
like gettext, intltool or pkg-config.

The dependency on gnome-common was originally added for the GNOME_GTKDOC_CHECK
macro which has been deprecated and replaced by GTK_DOC_CHECK a long time ago.

As gnome-common has been declared deprecated by GNOME upstream [1], we would
like to drop this dependency from gtk-doc-tools.

We did a test of all reverse build dependencies of gtk-doc-tools and 
at-spi2-core
failed to build due to now missing build dependencies which are no longer
pulled in by gtk-doc-tools.

A complete build log is available at
https://people.debian.org/~biebl/gtk-doc-tools/at-spi2-core.log

We have uploaded that gtk-doc-tools package as 1.25-4 to experimental as well,
so you can test your package against this version.

Common build-failures and their fixes:

a/ configure.ac:32: error: possibly undefined macro: AC_PROG_INTLTOOL

   make[1]: intltoolize: Command not found

   → Build-Depends: intltool

b/ ./configure: line 5461: syntax error near unexpected token `yes'
   ./configure: line 5461: `GNOME_COMPILE_WARNINGS(yes)'

   ./configure: line 14801: GNOME_CODE_COVERAGE: command not found

   → Build-Depends: gnome-common (for GNOME_* macros)

c/ ./configure: line 17439: syntax error near unexpected token 
`$WARN_CFLAGS_EXTRA,'
   ./configure: line 17439: `AX_APPEND_COMPILE_FLAGS($WARN_CFLAGS_EXTRA, 
WARN_CFLAGS)'

   ./configure: line 2629: syntax error near unexpected token `git-directory'
   ./configure: line 2629: `AX_IS_RELEASE(git-directory)'

   → Build-Depends: autoconf-archive (for AX_* macros)

d/ ./configure: line 12518: intltool-update: command not found
   checking for intltool >= 0.40.0...  found
   ./configure: error: Your intltool is too old.  You need intltool 0.40.0 or 
later.

   → Build-Depends: intltool

e/ make[1]: intltoolize: Command not found

   → Build-Depends: intltool

f/ ./autogen.sh calls gnome-autogen.sh

   → Build-Depends: gnome-common


Please add the required build-dependencies to your package so once we upload
gtk-doc-tools_1.25-4 to unstable your package doesn't FTBFS.

Regards,
Michael


[1] https://wiki.gnome.org/Projects/GnomeCommon/Migration
--- End Message ---
--- Begin Message ---
Source: at-spi2-core
Source-Version: 2.20.2-2

We believe that the bug you reported is fixed in the latest version of
at-spi2-core, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Samuel Thibault  (supplier of updated at-spi2-core 
package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Thu, 15 Sep 2016 01:52:36 +0200
Source: at-spi2-core
Binary: at-spi2-core at-spi2-core-udeb libatspi2.0-0 libatspi0-udeb 
libatspi2.0-dev gir1.2-atspi-2.0 at-spi2-doc
Architecture: source amd64 all
Version: 2.20.2-2
Distribution: unstable
Urgency: medium
Maintainer: Debian Accessibility Team 
Changed-By: Samuel Thibault 
Description:
 at-spi2-core - Assistive Technology Service Provider Interface (dbus core)
 at-spi2-core-udeb - Assistive Technology Service Provider Interface (dbus core 
for d- (udeb)
 at-spi2-doc - Assistive Technology Service Provider Interface (Documentation)
 gir1.2-atspi-2.0 - Assistive Technology Service Provider (GObject 
introspection)
 libatspi0-udeb - Assistive Technology Service Provider Interface - module for 
d-i (udeb)
 libatspi2.0-0 - Assistive Technology Service Provider Interface - shared 
library
 

Bug#837760: marked as done (kerneloops: conffiles not removed)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 23:20:29 +
with message-id 
and subject line Bug#837760: fixed in kerneloops 0.12+git20140509-5
has caused the Debian Bug report #837760,
regarding kerneloops: conffiles not removed
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837760: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837760
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: kerneloops
Version: 0.12+git20140509-4
Severity: normal
User: debian...@lists.debian.org
Usertags: obsolete-conffile adequate

The recent upgrade did not deal with obsolete conffiles properly.
Please use the dpkg-maintscript-helper support provided by dh_installdeb
to remove these obsolete conffiles on upgrade.

https://www.debian.org/doc/debian-policy/ch-files.html#s-config-files
https://manpages.debian.org/man/1/dh_installdeb

This bug report brought to you by adequate:

http://bonedaddy.net/pabs3/log/2013/02/23/inadequate-software/

$ pkg=kerneloops ; adequate $pkg ; dpkg-query -W -f='${Conffiles}\n' $pkg | 
grep obsolete
kerneloops: obsolete-conffile /etc/dbus-1/system.d/kerneloops.dbus
 /etc/dbus-1/system.d/kerneloops.dbus c3bd801edc11591f09c0a333d7c86a4f obsolete

-- System Information:
Debian Release: stretch/sid
  APT prefers testing-debug
  APT policy: (900, 'testing-debug'), (900, 'testing'), (800, 
'unstable-debug'), (800, 'unstable'), (790, 'buildd-unstable'), (700, 
'experimental-debug'), (700, 'experimental'), (690, 'buildd-experimental')
Architecture: amd64 (x86_64)

Kernel: Linux 4.6.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=en_AU.utf8, LC_CTYPE=en_AU.utf8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages kerneloops depends on:
ii  init-system-helpers  1.42
ii  libc62.24-2
ii  libcurl3-gnutls  7.50.1-1
ii  libdbus-1-3  1.10.10-1
ii  libdbus-glib-1-2 0.106-1
ii  libglib2.0-0 2.49.6-1
ii  lsb-base 9.20160629

Versions of packages kerneloops recommends:
ii  kerneloops-applet  0.12+git20140509-4

kerneloops suggests no packages.

-- no debconf information

-- 
bye,
pabs

https://wiki.debian.org/PaulWise


signature.asc
Description: This is a digitally signed message part
--- End Message ---
--- Begin Message ---
Source: kerneloops
Source-Version: 0.12+git20140509-5

We believe that the bug you reported is fixed in the latest version of
kerneloops, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Balint Reczey  (supplier of updated kerneloops package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 17:27:07 +0200
Source: kerneloops
Binary: kerneloops kerneloops-applet
Architecture: source
Version: 0.12+git20140509-5
Distribution: unstable
Urgency: medium
Maintainer: Balint Reczey 
Changed-By: Balint Reczey 
Description:
 kerneloops - kernel oops tracker
 kerneloops-applet - applet for the kernel oops tracker
Closes: 837760
Changes:
 kerneloops (0.12+git20140509-5) unstable; urgency=medium
 .
   * Rename conffile in maintainer scripts properly (Closes: 837760)
Checksums-Sha1:
 9a7527fb19b0e45893eb01d8fa3d2d3c4d0e7d8e 2141 kerneloops_0.12+git20140509-5.dsc
 5c0d071dc58522883b319bf8667b8843bc6e9aa4 10256 
kerneloops_0.12+git20140509-5.debian.tar.xz
Checksums-Sha256:
 e6ca9f3a8d439b1f66ccb2f7bca8c23aa99bc15b311ada2f11f1327b12c6c434 2141 
kerneloops_0.12+git20140509-5.dsc
 579cabb2d999df366dd8213a9dd050df084f25d3122fabf05f0470624065c917 10256 
kerneloops_0.12+git20140509-5.debian.tar.xz
Files:
 fcc300a7ea4c78c4a87ca3ccfa467044 2141 utils optional 
kerneloops_0.12+git20140509-5.dsc
 e615393b00eea0ad0fa6bed4a2747e2d 10256 utils optional 
kerneloops_0.12+git20140509-5.debian.tar.xz

-BEGIN PGP SIGNATURE-
Version: GnuPG v1

iQIcBAEBCAAGBQJX2czcAAoJEPZk0la0aRp9B2UQALkj8p5YkVbwOzgvUvhCfufK
516TEbsB3WusbR0ynecR6u9TnZ0z7+yPNi9XEgwvr9Foc/oKISyDsCAzjM8HhWxy
Z8V0ooMxy9aQb9Ckvl6iLi9aRRk2B7ySKrUunOzAaI30dspGENqHsGhrWfMocZkf
I+Bc+KaMgLFxGgbq/+GhvMnfBmG4O4Nd2YjCmAH4GRr/5peYd4pjCHGNiTFTliA8
VCmK87XUJeaZiu4aqFjLLiR1crRz10t9LsKmN8h7maf840

Bug#836259: marked as done (gnupg2: accesses the internet during build)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 22:22:55 +
with message-id 
and subject line Bug#836259: fixed in gnupg2 2.1.15-3
has caused the Debian Bug report #836259,
regarding gnupg2: accesses the internet during build
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
836259: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836259
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: gnupg2
Version: 2.1.15-1
Severity: serious
Justification: Policy 4.9
User: la...@debian.org
Usertags: network-access

Dear Maintainer,

Whilst gnupg2 builds successfully on unstable/amd64, according to
Debian Policy 4.9 packages may not attempt network access during
a build.

  00:00:00.00 IP 2144c8152453.52165 > 10.0.1.1.domain: 10277+ CERT? 
simon.josefsson.org. (37)
  00:00:02.091222 IP 10.0.1.1.domain > 2144c8152453.52165: 10277 ServFail 0/0/0 
(37)
  00:00:02.091449 IP 2144c8152453.33849 > 10.0.1.1.domain: 10277+ CERT? 
simon.josefsson.org. (37)
  00:00:04.189179 IP 10.0.1.1.domain > 2144c8152453.33849: 10277 ServFail 0/0/0 
(37)
  00:00:04.189389 IP 2144c8152453.43668 > 10.0.1.1.domain: 10277+ CERT? 
simon.josefsson.org. (37)
  00:00:06.327647 IP 10.0.1.1.domain > 2144c8152453.43668: 10277 ServFail 0/0/0 
(37)
  00:00:06.327842 IP 2144c8152453.51705 > 10.0.1.1.domain: 10277+ CERT? 
simon.josefsson.org. (37)
  00:00:08.373406 IP 10.0.1.1.domain > 2144c8152453.51705: 10277 ServFail 0/0/0 
(37)

  [..]

The full build log (including tcpdump output) is attached.


Regards,

-- 
  ,''`.
 : :'  : Chris Lamb
 `. `'`  la...@debian.org / chris-lamb.co.uk
   `-


gnupg2.2.1.15-1.unstable.amd64.log.txt.gz
Description: Binary data
--- End Message ---
--- Begin Message ---
Source: gnupg2
Source-Version: 2.1.15-3

We believe that the bug you reported is fixed in the latest version of
gnupg2, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 836...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Daniel Kahn Gillmor  (supplier of updated gnupg2 
package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Wed, 14 Sep 2016 17:08:58 -0400
Source: gnupg2
Binary: gnupg-agent scdaemon gpgsm gnupg gnupg2 gpgv gpgv2 dirmngr gpgv-udeb 
gpgv-win32 gnupg-l10n
Architecture: source
Version: 2.1.15-3
Distribution: unstable
Urgency: medium
Maintainer: Debian GnuPG Maintainers 
Changed-By: Daniel Kahn Gillmor 
Description:
 dirmngr- GNU privacy guard - network certificate management service
 gnupg  - GNU privacy guard - a free PGP replacement
 gnupg-agent - GNU privacy guard - cryptographic agent
 gnupg-l10n - GNU privacy guard - localization files
 gnupg2 - GNU privacy guard - a free PGP replacement (dummy transitional pa
 gpgsm  - GNU privacy guard - S/MIME version
 gpgv   - GNU privacy guard - signature verification tool
 gpgv-udeb  - minimal signature verification tool (udeb)
 gpgv-win32 - GNU privacy guard - signature verification tool (win32 build)
 gpgv2  - GNU privacy guard - signature verification tool (dummy transition
 scdaemon   - GNU privacy guard - smart card support
Closes: 836259
Changes:
 gnupg2 (2.1.15-3) unstable; urgency=medium
 .
   * Use upstream fix to avoid touching homedir during test suite
   * backward compatibility for preset-passphrase and protect-tool
   * add Breaks: for python3-apt too (thanks, Harald Jenny!)
   * Avoid network access during tests (Closes: #836259)
   * more patches from upstream
- gpgv --output now works
- fingerprint display doesn't vary with --keyid-format
- minor cleanup to scdaemon dealing with removed cards
Checksums-Sha1:
 ac5f86ca26fb3bea7762f57c9ea7482761f2046d 3191 gnupg2_2.1.15-3.dsc
 7d02d4ca69f12284ac0505f1944e4ca589641ebe 53648 gnupg2_2.1.15-3.debian.tar.bz2
Checksums-Sha256:
 873693e194498b03e3a6c984920b6c88779e9a121782bc3c0b51f99fde6812f0 3191 
gnupg2_2.1.15-3.dsc
 7870c91a2431a7db3bf64a865c8563630b4b5b0da52f42d694d930f554e704f1 53648 
gnupg2_2.1.15-3.debian.tar.bz2
Files:
 8f196b5f676848aa87b03085f6706bac 3191 utils optional gnupg2_2.1.15-3.dsc
 be80912ace1cdf8f12aa285adfe6877d 53648 utils optional 
gnupg2_2.1.15-3.debian.tar.

Bug#837594: marked as done (gnome-shell-extension-autohidetopbar: Not compatible with gnome-shell 3.21.x/3.22)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 22:22:42 +
with message-id 
and subject line Bug#837594: fixed in gnome-shell-extension-autohidetopbar 
20160828-2
has caused the Debian Bug report #837594,
regarding gnome-shell-extension-autohidetopbar: Not compatible with gnome-shell 
3.21.x/3.22
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837594: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837594
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: gnome-shell-extension-autohidetopbar
Version: 20160828-1
Severity: serious
User: pkg-gnome-maintain...@lists.alioth.debian.org
Usertags: gnome-shell-3-22

Hi,

your package gnome-shell-extension-autohidetopbar declares a strictly
versioned dependency on gnome-shell. We've uploaded gnome-shell
3.21.91 to unstable, which makes gnome-shell-extension-autohidetopbar
uninstallable.

Please test if your package is compatible with that version and
update the information in metadata.json and the package dependencies
accordingly.

There will be one more development release, 3.21.92, before the final
version 3.22.0 is released [1]. gnome-shell development is frozen, so
if gnome-shell-extension-autohidetopbar works with 3.21.91, it's
pretty safe to assume it will also work with 3.21.92 and 3.22. So you
might list those as supported versions as well

Regards, Michael

[1] https://wiki.gnome.org/ThreePointTwentyone
--- End Message ---
--- Begin Message ---
Source: gnome-shell-extension-autohidetopbar
Source-Version: 20160828-2

We believe that the bug you reported is fixed in the latest version of
gnome-shell-extension-autohidetopbar, which is due to be installed in the 
Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Tobias Frost  (supplier of updated 
gnome-shell-extension-autohidetopbar package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 08:05:15 +0200
Source: gnome-shell-extension-autohidetopbar
Binary: gnome-shell-extension-autohidetopbar
Architecture: source
Version: 20160828-2
Distribution: unstable
Urgency: medium
Maintainer: Tobias Frost 
Changed-By: Tobias Frost 
Description:
 gnome-shell-extension-autohidetopbar - GNOME shell automatic topbar hider
Closes: 837594
Changes:
 gnome-shell-extension-autohidetopbar (20160828-2) unstable; urgency=medium
 .
   * d/control: Relax upper version limit on gnome-shell. (Closes: #837594)
 As the next Gnome version will by default not enforce the version via
 metadata.json, a change in this file is not required. See the bug for
 details.
Checksums-Sha1:
 c9c03e85b95832719b3157c253db82b457d61082 2167 
gnome-shell-extension-autohidetopbar_20160828-2.dsc
 23be1e456f7cc97ffad3d7b8e77a4251539e28c4 4200 
gnome-shell-extension-autohidetopbar_20160828-2.debian.tar.xz
Checksums-Sha256:
 ad774d7cece0050cec93dc67ff4278036cfdad166d01eb7b165efd511267cab2 2167 
gnome-shell-extension-autohidetopbar_20160828-2.dsc
 478df49d3103d2d5c67e2a1a8936b5eeb49d85ef38391396fa852c263449c98c 4200 
gnome-shell-extension-autohidetopbar_20160828-2.debian.tar.xz
Files:
 f592f9cfaf7a05914415c21aa159937f 2167 gnome optional 
gnome-shell-extension-autohidetopbar_20160828-2.dsc
 027e545cff3d8db575f539b3eafa46f3 4200 gnome optional 
gnome-shell-extension-autohidetopbar_20160828-2.debian.tar.xz

-BEGIN PGP SIGNATURE-

iQIcBAEBCAAGBQJX2OnBAAoJEJFk+h0XvV027N0QAIxbVM+TDAfO4Jb6ItxGXhgY
LPdeoYB1LpMgcjNhs1QLOaRt8jXcQKqoFhAtjRipdHsz9wVjaJLR2xRD7Zxkv2Vl
FhSMu/hN1VB3fB5bcb+AnaG3lFMFss99cDFenHTAbBqR6XRsv6+CyxyQCFA0tek1
4rZ50uf5i/Z92PCWsckZQKUu3BPDKoJuW4ksSgWChspiiCI0vP5uUtofwaXLeInx
ohWjYsBbDHIuBaluPc5vAxJTbfOn0elXFfP9DBIwgo1IHzkZ9XIpWLK50wceAlmT
KTGNN6ybc+0llYc4GOGcSQi/BssP2EhbtAElXi2P14AUIiG+LNs71JY0BtSfHoas
cWMT6Btk2VSxkEvRrVJGLkMRMZivx8ZPTPILlen+Y3lJPnFwB716cxYVPxD5MiuH
XajsZG+M2+PgNcZY1BAC976P4MmwxBOH6AWCNdKls+XDpd/FcgMA8+BCbBjr4qHb
03DS3+Q7Dr1Va8aJjx1if6aQpaGpd/lfxL66Hx7CHrnnhbRtMyqPacxWh5WGZjWL
b6SAmSOYuTYIgsMZSpM+BqY93lcWCg5IGZCkiydV9JEQ249glMwAbU61eLCp+OHi
WVQ62PRx4ZC0xdV2ovSFHP/fe+EUL8HIh7UdaMaJ/ltpb9qz3891ZR0EZvkECkX6
cke3NnZp8tGg0rnRkMi8
=8uqA
-END PGP SIGNATURE End Message ---


Bug#834251: marked as done (openmw: FTBFS with GCC 6)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 22:24:55 +
with message-id 
and subject line Bug#834251: fixed in openmw 0.38.0-3
has caused the Debian Bug report #834251,
regarding openmw: FTBFS with GCC 6
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
834251: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=834251
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: openmw
Version: 0.38.0-1
Severity: serious

Dear maintainer:

This package currently fails to build from source in stretch:

-
In file included from /usr/include/c++/6/unordered_map:35:0,
 from
/<>/components/files/configurationmanager.hpp:7,
 from
/<>/components/files/configurationmanager.cpp:1:
/usr/include/c++/6/bits/c++0x_warning.h:32:2: error: #error This file
requires compiler and library support for the ISO C++ 2011 standard.
This support must be enabled with the -std=c++11 or -std=gnu++11
compiler options.
 #error This file requires compiler and library support \
   ^
-

The full build log is attached.

(Note: The build log is for "dpkg-buildpackage -A" but that's probably
irrelevant considering the way it fails).

Thanks.

openmw_0.38.0-1_amd64-20160812-1532.gz
Description: application/gzip
--- End Message ---
--- Begin Message ---
Source: openmw
Source-Version: 0.38.0-3

We believe that the bug you reported is fixed in the latest version of
openmw, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 834...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Bret Curtis  (supplier of updated openmw package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Wed, 14 Sep 2016 08:14:09 +0200
Source: openmw
Binary: openmw openmw-cs openmw-data openmw-launcher
Architecture: source
Version: 0.38.0-3
Distribution: unstable
Urgency: low
Maintainer: Bret Curtis 
Changed-By: Bret Curtis 
Description:
 openmw - Reimplementation of The Elder Scrolls III: Morrowind
 openmw-cs  - Replacement of The Elder Scrolls Construction Set
 openmw-data - Resources for the OpenMW engine
 openmw-launcher - Launcher for OpenMW using the Qt-Gui-Toolkit
Closes: 834251
Changes:
 openmw (0.38.0-3) unstable; urgency=low
 .
   [ Bret Curtis ]
   * Added patch to replace unordered_map with map (Closes: #834251)
 .
 openmw (0.38.0-2) unstable; urgency=low
 .
   [ Bret Curtis ]
   * Updated Standards-Version
   * Removed unnecessary depends.
Checksums-Sha1:
 b4d34ea73caad14f3663ec5a16277fdf71352a68 2305 openmw_0.38.0-3.dsc
 cde667451c4fd298f35b524dcd788ceb2c2a26b3 8048 openmw_0.38.0-3.debian.tar.xz
Checksums-Sha256:
 d9451071e9fa5973d3212af8cdac9c89c35c52bef71ac0cc3935c1b75b1fed4c 2305 
openmw_0.38.0-3.dsc
 1665a93a3cef6a8d08ddcb80005d0e5cc4e0ca647f98c350868ea51c622824de 8048 
openmw_0.38.0-3.debian.tar.xz
Files:
 dea6c486fc4e1fa35114bbb790599402 2305 contrib/games optional 
openmw_0.38.0-3.dsc
 fd884e0022a4071f4bd3360065bd2d6c 8048 contrib/games optional 
openmw_0.38.0-3.debian.tar.xz

-BEGIN PGP SIGNATURE-
Version: GnuPG v1

iQIcBAEBCgAGBQJX2bIVAAoJEK/P7I5mnOHCSnQP/i/i8422VZyhODZBt9pwEjFJ
nSUYW19mnPzUkirpS86X2UHiXz4idU4U2Sa2OLNjbg/gcvgVhyXPLTsgh3myjP+J
CqiTS53bLPzei8oSpSdSoJfUNzuvXqj6QyXkum/Z5bFcZuFRoPLhZWVtlX1AfTva
S9BjSRhDKRZmxqt7H11sPfJvh03vMm6yD7JHo4uHmFESQ0cjbUzxY7kXMJHAzPxl
2Ru9tMSNBTApEEwd6TQI1lxyY1nFmB1wkR6puKFUWyLeTQC6tR9XgOn3MnF/ZMRC
2jXv/PCQcFdBCNy4dsBK77poLRl6RUzI5xNihVDT1aRWwm32KtryuJmkl6CklvqP
+2SPjMc6IpseHUW5Ip2jf0TW6bC9ujfHnVwrjdRs4gMbxq7Wtmz3dClahkjvyLJ+
wqh85MW+ITeF31rfdgeiJtfmI0c6fS7kcJ0Vur14Yw4jfi+Haon43Y9fL8FOlrXO
rPoJHYvIQGbZ6IJs5n1+fwUKFadFmTDucyUVHZdPFrueEpja4Sh98HPTb0n9dfX3
y8gxXXJvcDOYxDLv4YC+mmUWQbzBOKn5UTKzpMHRmLBp378SsiKdlXOk1rqYDZKp
7HGTSVFr5rW+LjmtsuVE7yZ+l0S12IFdBRLdWN8pkVa3OtmmSEFMRlxEyuIs22U0
09Wp9KIYR04syHCnAgsO
=KnTk
-END PGP SIGNATURE End Message ---


Bug#827049: marked as done (libnet-ssleay-perl: FTBFS with OpenSSL 1.1 in experimental)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 23:47:01 +0200
with message-id <20160914214701.v6uee3ylzvj4o...@jadzia.comodo.priv.at>
and subject line Re: Bug#827049: libnet-ssleay-perl: FTBFS with OpenSSL 1.1 in 
experimental
has caused the Debian Bug report #827049,
regarding libnet-ssleay-perl: FTBFS with OpenSSL 1.1 in experimental
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
827049: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=827049
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: libnet-ssleay-perl
Version: 1.74-1
Severity: important
Forwarded: https://rt.cpan.org/Ticket/Display.html?id=115271

As reported on debian-devel[1] this package FTBFS with openssl 1.1.

https://breakpoint.cc/openssl-1.1-rebuild-2016-05-29/Attempted/libnet-ssleay-perl_1.74-1_amd64-20160529-1442

[1] 
--- End Message ---
--- Begin Message ---
On Wed, 14 Sep 2016 23:34:34 +0200, Sebastian Andrzej Siewior wrote:

> can you close this or merge it with #828401 (which is archived).

Good catch, thanks.

Closing now.

Cheers,
gregor

-- 
 .''`.  Homepage https://info.comodo.priv.at/ - OpenPGP key 0xBB3A68018649AA06
 : :' : Debian GNU/Linux user, admin, and developer -  https://www.debian.org/
 `. `'  Member of VIBE!AT & SPI, fellow of the Free Software Foundation Europe
   `-   NP: Melissa Etheridge: Walking on Water


signature.asc
Description: Digital Signature
--- End Message ---


Bug#809832: marked as done (base: fails to inser modules ext2 or ext3)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 22:46:15 +0200 (CEST)
with message-id 
and subject line Re: base: fails to inser modules ext2 or ext3
has caused the Debian Bug report #809832,
regarding base: fails to inser modules ext2 or ext3
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
809832: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=809832
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: base
Severity: critical
Justification: breaks unrelated software

# LANG=C mount -o ro /dev/sdc1 /mnt/disk/
mount: unknown filesystem type 'ext2'

# modprobe -vv ext2
insmod /lib/modules/3.2.0-4-amd64/kernel/fs/ext2/ext2.ko
libkmod: INFO ../libkmod/libkmod-module.c:829 kmod_module_insert_module: Failed
to insert module '/lib/modules/3.2.0-4-amd64/kernel/fs/ext2/ext2.ko': No such
file or directory
ERROR: could not insert 'ext2': Unknown symbol in module, or unknown parameter
(see dmesg)
libkmod: INFO ../libkmod/libkmod.c:319 kmod_unref: context 0x7fa6136ae210
released

/var/log/kern.log:
Jan  4 11:19:50 dbdev kernel: [1561590.271996] ext2: Unknown symbol __bread_gfp
(err 0)
Jan  4 11:19:50 dbdev kernel: [1561590.272039] ext2: Unknown symbol
__getblk_gfp (err 0)



-- System Information:
Debian Release: 7.9
  APT prefers oldstable-updates
  APT policy: (500, 'oldstable-updates'), (500, 'oldstable')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 3.2.0-4-amd64 (SMP w/4 CPU cores)
Locale: LANG=es_UY.UTF-8, LC_CTYPE=es_UY.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/bash
--- End Message ---
--- Begin Message ---
Hello.

[ Sorry for all the time you waited before receiving a reply, there are
  not many people answering to bugs in "base", and we really prefer bugs
  about real packages and not this "base" pseudo-package ].

On Mon, 4 Jan 2016, Mario Pereyra wrote:

> Package: base
> Severity: critical
> Justification: breaks unrelated software
> 
> # LANG=C mount -o ro /dev/sdc1 /mnt/disk/
> mount: unknown filesystem type 'ext2'
> 
> # modprobe -vv ext2
> insmod /lib/modules/3.2.0-4-amd64/kernel/fs/ext2/ext2.ko
> libkmod: INFO ../libkmod/libkmod-module.c:829 kmod_module_insert_module: 
> Failed
> to insert module '/lib/modules/3.2.0-4-amd64/kernel/fs/ext2/ext2.ko': No such
> file or directory

The error message itself explains why it can't load the ext2 module:

It can't because the file /lib/modules/3.2.0-4-amd64/kernel/fs/ext2/ext2.ko
does not seem to exist.

This file was in the linux-image-3.2.0-4-amd64 package in Debian 7:

$ dpkg -c linux-image-3.2.0-4-amd64_3.2.78-1_amd64.deb | grep ext2
drwxr-xr-x root/root 0 2016-03-09 05:25 
./lib/modules/3.2.0-4-amd64/kernel/fs/ext2/
-rw-r--r-- root/root103568 2016-03-09 05:25 
./lib/modules/3.2.0-4-amd64/kernel/fs/ext2/ext2.ko

Why the file was not there in your system?

We will probably never know with the information provided in the bug.

So, we are sorry but even if this was a real bug that we could fix,
we would not even know where to start for lack of information.

In Debian 8, there is not even ext2/ext3 independent modules by default,
as the same ext4 module is able to mount ext2, ext3 and ext4 partitions,
so in some sense, we can consider this to be fixed in Debian 8.

Thanks.--- End Message ---


Bug#837803: marked as done (RM: rna-star [m68k sh4 x32] -- RoM; ANAIS; not built on some archs anymore)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 16:29:45 -0400
with message-id 
and subject line Re: Bug#837803: RM: rna-star [m68k sh4 x32] -- RoM; ANAIS; not 
built on some archs anymore
has caused the Debian Bug report #837803,
regarding RM: rna-star [m68k sh4 x32] -- RoM; ANAIS; not built on some archs 
anymore
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837803: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837803
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: ftp.debian.org
Severity: normal

Please remove the out-of-date binaries for rna-star for m68k, sh4 and x32.
These were built but did not work in previous versions, as recently introduced
build time tests have shown.
These archs have since then be removed from the architecture list.

Thanks
Sascha (rna-star co-maintainer)
--- End Message ---
--- Begin Message ---
Those are all ports architectures which are not managed by the FTP team.

Scott K

On September 14, 2016 3:57:56 PM EDT, Sascha Steinbiss  wrote:
>Package: ftp.debian.org
>Severity: normal
>
>Please remove the out-of-date binaries for rna-star for m68k, sh4 and
>x32.
>These were built but did not work in previous versions, as recently
>introduced
>build time tests have shown.
>These archs have since then be removed from the architecture list.
>
>Thanks
>Sascha (rna-star co-maintainer)--- End Message ---


Bug#795976: marked as done (sphinx: please make the build reproducible (timestamps, randomness))

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 23:25:46 +0300
with message-id <8257325e-e00c-43a2-bc38-0b265bb7c...@debian.org>
and subject line Re: reopening 795976
has caused the Debian Bug report #795976,
regarding sphinx: please make the build reproducible (timestamps, randomness)
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
795976: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=795976
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: sphinx
Version: 1.3.1-4
Severity: wishlist
Tags: patch
User: reproducible-bui...@lists.alioth.debian.org
Usertags: timestamps randomness
X-Debbugs-Cc: reproducible-bui...@lists.alioth.debian.org

Hi!

While working on the “reproducible builds” effort [1], we have noticed
that sphinx could not be built reproducibly.

The attached patch removes build timestamp from the output
documentation, makes domains sorted in HTML documentation, and makes
generated automata (and their pickle dump) deterministic. Once applied,
sphinx (and packages using sphinx) can be built reproducibly in our
current experimental framework.

 [1]: https://wiki.debian.org/ReproducibleBuilds

Regards,
Val
diff -ru sphinx-1.3.1.old/debian/rules sphinx-1.3.1/debian/rules
--- sphinx-1.3.1.old/debian/rules	2015-08-17 17:41:44.55734 +
+++ sphinx-1.3.1/debian/rules	2015-08-18 12:26:01.040804815 +
@@ -3,11 +3,14 @@
 
 include /usr/share/python/python.mk
 
+export SOURCE_DATE_EPOCH = $(shell date -d "$$(dpkg-parsechangelog --count 1 -SDate)" +%s)
 export NO_PKG_MANGLE=1
 export PYTHONWARNINGS=d
-export PYTHONHASHSEED=random
 export http_proxy=http://127.0.0.1:9/
 
+# For deterministic pickling
+export PYTHONHASHSEED=0
+
 here = $(dir $(firstword $(MAKEFILE_LIST)))/..
 debian_version = $(word 2,$(shell cd $(here) && dpkg-parsechangelog | grep ^Version:))
 upstream_version = $(subst ~,,$(firstword $(subst -, ,$(debian_version
diff -ru sphinx-1.3.1.old/setup.py sphinx-1.3.1/setup.py
--- sphinx-1.3.1.old/setup.py	2015-08-17 17:41:44.55734 +
+++ sphinx-1.3.1/setup.py	2015-08-18 11:41:20.0 +
@@ -162,7 +162,7 @@
 messages=jscatalog,
 plural_expr=catalog.plural_expr,
 locale=str(catalog.locale)
-), outfile)
+), outfile, sort_keys=True)
 outfile.write(');')
 finally:
 outfile.close()
diff -ru sphinx-1.3.1.old/sphinx/builders/html.py sphinx-1.3.1/sphinx/builders/html.py
--- sphinx-1.3.1.old/sphinx/builders/html.py	2015-08-17 17:41:44.56534 +
+++ sphinx-1.3.1/sphinx/builders/html.py	2015-08-17 19:46:48.0 +
@@ -824,7 +824,7 @@
  u'# The remainder of this file is compressed using zlib.\n'
  % (self.config.project, self.config.version)).encode('utf-8'))
 compressor = zlib.compressobj(9)
-for domainname, domain in iteritems(self.env.domains):
+for domainname, domain in sorted(self.env.domains.items()):
 for name, dispname, type, docname, anchor, prio in \
 sorted(domain.get_objects()):
 if anchor.endswith(name):
diff -ru sphinx-1.3.1.old/sphinx/pycode/pgen2/pgen.py sphinx-1.3.1/sphinx/pycode/pgen2/pgen.py
--- sphinx-1.3.1.old/sphinx/pycode/pgen2/pgen.py	2015-08-17 17:41:44.56134 +
+++ sphinx-1.3.1/sphinx/pycode/pgen2/pgen.py	2015-08-18 12:06:30.0 +
@@ -4,6 +4,7 @@
 from __future__ import print_function
 
 from six import iteritems
+from collections import OrderedDict
 
 # Pgen imports
 
@@ -57,7 +58,7 @@
 def make_first(self, c, name):
 rawfirst = self.first[name]
 first = {}
-for label in rawfirst:
+for label in sorted(rawfirst):
 ilabel = self.make_label(c, label)
 ##assert ilabel not in first # X X X failed on <> ... !=
 first[ilabel] = 1
@@ -138,8 +139,8 @@
 totalset[label] = 1
 overlapcheck[label] = {label: 1}
 inverse = {}
-for label, itsfirst in iteritems(overlapcheck):
-for symbol in itsfirst:
+for label, itsfirst in sorted(overlapcheck.items()):
+for symbol in sorted(itsfirst):
 if symbol in inverse:
 raise ValueError("rule %s is ambiguous; %s is in the"
  " first sets of %s as well as %s" %
@@ -349,6 +350,9 @@
 assert isinstance(next, NFAState)
 self.arcs.append((label, next))
 
+def 

Bug#822104: marked as done (guessnet: FTBFS: *** libiw not found. Check 'config.log' for more details.)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 22:21:25 +0200
with message-id <20160914202124.gc5...@reiner-h.de>
and subject line Re: guessnet: FTBFS: *** libiw not found. Check 'config.log' 
for more details.
has caused the Debian Bug report #822104,
regarding guessnet: FTBFS: *** libiw not found. Check 'config.log' for more 
details.
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
822104: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=822104
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: guessnet
Version: 0.56
Severity: serious
Justification: fails to build from source
User: reproducible-bui...@lists.alioth.debian.org
Usertags: ftbfs
X-Debbugs-Cc: reproducible-bui...@lists.alioth.debian.org

Dear Maintainer,

guessnet fails to build from source in unstable/amd64:

  [..]

  dh_testdir
  dh_testroot
  dh_prep
  dh_testdir
  dh_testroot
  dh_install
  dh_installdocs
  dh_installchangelogs
  dh_compress
  dh_fixperms
  dh_installdeb
  dh_gencontrol
  dh_md5sums
  dh_builddeb
  dpkg-deb: building package 'guessnet-build-deps' in 
'../guessnet-build-deps_0.56_all.deb'.
  
  The package has been created.
  Attention, the package has been created in the current directory,
  not in ".." as indicated by the message above!
  Selecting previously unselected package guessnet-build-deps.
  (Reading database ... 22998 files and directories currently installed.)
  Preparing to unpack guessnet-build-deps_0.56_all.deb ...
  Unpacking guessnet-build-deps (0.56) ...
  Reading package lists...
  Building dependency tree...
  Reading state information...
  Correcting dependencies... Done
  The following additional packages will be installed:
cdbs dh-buildinfo libiw-dev libiw30 libnet1 libnet1-dev libpcap-dev
libpcap0.8 libpcap0.8-dev libtut-dev libwibble-dev pkgconf
  Suggested packages:
pkg-config
  The following NEW packages will be installed:
cdbs dh-buildinfo libiw-dev libiw30 libnet1 libnet1-dev libpcap-dev
libpcap0.8 libpcap0.8-dev libtut-dev libwibble-dev pkgconf
  0 upgraded, 12 newly installed, 0 to remove and 0 not upgraded.
  1 not fully installed or removed.
  Need to get 1831 kB of archives.
  After this operation, 18.4 MB of additional disk space will be used.
  Get:1 http://httpredir.debian.org/debian sid/main amd64 cdbs all 0.4.130 
[76.4 kB]
  Get:2 http://httpredir.debian.org/debian sid/main amd64 dh-buildinfo all 
0.11+nmu1 [18.1 kB]
  Get:3 http://httpredir.debian.org/debian sid/main amd64 libnet1 amd64 
1.1.6+dfsg-3 [60.4 kB]
  Get:4 http://httpredir.debian.org/debian sid/main amd64 libnet1-dev amd64 
1.1.6+dfsg-3 [118 kB]
  Get:5 http://httpredir.debian.org/debian sid/main amd64 libpcap0.8 amd64 
1.7.4-2 [136 kB]
  Get:6 http://httpredir.debian.org/debian sid/main amd64 libpcap0.8-dev amd64 
1.7.4-2 [233 kB]
  Get:7 http://httpredir.debian.org/debian sid/main amd64 libpcap-dev all 
1.7.4-2 [24.0 kB]
  Get:8 http://httpredir.debian.org/debian sid/main amd64 libtut-dev all 
0.0.20070706-1 [99.2 kB]
  Get:9 http://httpredir.debian.org/debian sid/main amd64 libwibble-dev amd64 
1.1-1+b1 [977 kB]
  Get:10 http://httpredir.debian.org/debian sid/main amd64 pkgconf amd64 
0.9.12-1 [29.5 kB]
  Get:11 http://httpredir.debian.org/debian sid/main amd64 libiw30 amd64 
30~pre9-9 [21.2 kB]
  Get:12 http://httpredir.debian.org/debian sid/main amd64 libiw-dev amd64 
30~pre9-9 [38.8 kB]
  Fetched 1831 kB in 0s (85.0 MB/s)
  Selecting previously unselected package cdbs.
  (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 23002 files and directories currently installed.)
  Preparing to unpack .../archives/cdbs_0.4.130_all.deb ...
  Unpacking cdbs (0.4.130) ...
  Selecting previously unselected package dh-buildinfo.
  Preparing to unpack .../dh-buildinfo_0.11+nmu1_all.deb ...
  Unpacking dh-buildinfo (0.11+nmu1) ...
  Selecting previously unselected package libnet1:amd64.
  Preparing to unpack .../libnet1_1.1.6+dfsg-3_amd64.deb ...
  Unpacking libnet1:amd64 (1.1.6+dfsg-3) ...
  Selecting previously unselected package libnet1-dev.
  Preparing to unpack .../libnet1-dev_1.1.6+dfsg

Bug#606337: marked as done (po4a: [text] Add support for SiSU markup)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 21:26:48 +0200
with message-id <20160914192648.as5lknwg2wkrbk2j@nouzonket>
and subject line Re: Bug#606337: po4a: [text] Add support for SiSU markup
has caused the Debian Bug report #606337,
regarding po4a: [text] Add support for SiSU markup
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
606337: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=606337
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: po4a
Version: 0.40.2-1
Severity: wishlist
Tags: patch

Please provide support for the SiSU markup language along the same lines as 
markdown and asciidoc which are supported as options in the Text module.

Currently the Debian Live manual translations of SiSU files (processed as 
[type: text]) are corrupted whenever we use SiSU point-form lists. SiSU cannot 
handle line wraps, and the po4a Text module fails to detect '_*' SiSU markup, 
which must appear at the beginning of the line and with no leading whitespace, 
as bullet points. Detecting these lines and adding the 'no-wrap' option as per 
the attached patch resolves the issue.

Thanks,
Ben
Index: lib/Locale/Po4a/Text.pm
===
--- lib/Locale/Po4a/Text.pm	(revision 2461)
+++ lib/Locale/Po4a/Text.pm	(working copy)
@@ -141,6 +141,14 @@
 
 my $asciidoc = 0;
 
+=item B
+
+Handle documents in the SiSU format.
+
+=cut
+
+my $sisu = 0;
+
 =back
 
 =cut
@@ -156,6 +164,7 @@
 $self->{options}{'fortunes'} = 1;
 $self->{options}{'markdown'} = 1;
 $self->{options}{'nobullets'} = 1;
+$self->{options}{'sisu'} = 1;
 $self->{options}{'tabs'} = 1;
 $self->{options}{'verbose'} = 1;
 
@@ -191,6 +200,7 @@
 }
 
 $asciidoc=1 if (defined $options{'asciidoc'});
+$sisu=1 if (defined $options{'sisu'});
 }
 
 sub parse {
@@ -606,6 +616,13 @@
 do_paragraph($self,$paragraph,$wrapped_mode);
 $paragraph="$line\n";
 $wrapped_mode = 1;
+} elsif ($sisu and
+ (   $line =~ /^_\*/ )) { # bullet
+# Preserve some SiSU markup as a single line
+do_paragraph($self,$paragraph,$wrapped_mode);
+$paragraph="$line\n";
+$wrapped_mode = 0;
+$end_of_paragraph = 1;
 } elsif ($tabs eq "split" and $line =~ m/\t/ and $paragraph !~ m/\t/s) {
 $wrapped_mode = 0;
 do_paragraph($self,$paragraph,$wrapped_mode);
--- End Message ---
--- Begin Message ---
Perfect, then. I'm closing this bug.

As for future evolutions, please understand that I barely have the
free cycles to do the basic maintaining of the package. Patches will
have better chances of being served than feature requests ;)

Sorry about that, but I prefer being honnest about what I can do for
po4a right now.

Thanks for your interest,
Mt.

On Wed, Sep 14, 2016 at 12:46:55PM -0400, Ralph Amissah wrote:
> Please close bug (and do not apply patch).
> 
> As far as I understand it the patch was not needed, and ended up
> being forgotten about.

-- 
J'aime mon pays mais je crains mon gouvernement.  -- Anonyme


signature.asc
Description: PGP signature
--- End Message ---


Bug#818067: marked as done (ncurses: Please make ncurses reproducible)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 19:06:07 +
with message-id 
and subject line Bug#818067: fixed in ncurses 6.0+20160910-1
has caused the Debian Bug report #818067,
regarding ncurses: Please make ncurses reproducible
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
818067: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=818067
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: ncurses
Severity: wishlist
Tags: patch

Hi,

While working on the “reproducible builds” effort [1], we have noticed
that ncurses could not be built reproducibly.

We have found that MKterminfo.sh included a trailing space in one
build test but not in the other.  It is not quite clear to me what
triggers this behaviour, but there is a note claiming it to be the
locale difference (one build is in C and the other in a French UTF-8
locale).

The attached patch makes MKterminfo.sh strip trailing spaces from the
CAP file, which removes a source of non-determinism.  Once applied,
ncurses can be built reproducibly in our current experimental
framework.

 [1]: https://wiki.debian.org/ReproducibleBuilds

Thanks,
~Niels
>From 94dcd2cd7202f3671ca574bba9b798de5d701887 Mon Sep 17 00:00:00 2001
From: Niels Thykier 
Date: Sun, 13 Mar 2016 09:29:25 +
Subject: [PATCH] Strip trailing whitespace in the terminfo manpage

Signed-off-by: Niels Thykier 
---
 .../04-strip-trailing-whitespace-in-terminfo.diff   | 21 +
 debian/patches/series   |  1 +
 2 files changed, 22 insertions(+)
 create mode 100644 debian/patches/04-strip-trailing-whitespace-in-terminfo.diff

diff --git a/debian/patches/04-strip-trailing-whitespace-in-terminfo.diff b/debian/patches/04-strip-trailing-whitespace-in-terminfo.diff
new file mode 100644
index 000..5faefba
--- /dev/null
+++ b/debian/patches/04-strip-trailing-whitespace-in-terminfo.diff
@@ -0,0 +1,21 @@
+Author: Niels Thykier 
+Description: Strip leading whitespace in the terminfo manpage
+ In the reproducible build tests, the trailing space is
+ included in one build but not in the other.
+ .
+ It is not quite obvious to me what triggers this (difference in
+ locale being expected reason), but we can simply strip the space and
+ it works.
+
+diff --git a/man/MKterminfo.sh b/man/MKterminfo.sh
+index 3a99609..4577b0e 100755
+--- a/man/MKterminfo.sh
 b/man/MKterminfo.sh
+@@ -69,6 +69,7 @@ trap "rm -f $sorted $temp $unsorted; exit 99" 1 2 5 15
+ 
+ sed -n <$caps "\
+ /%%-STOP-HERE-%%/q
++s/\s*$//
+ /^#%/s/#%//p
+ /^#/d
+ s/[	][	]*/	/g
diff --git a/debian/patches/series b/debian/patches/series
index 45a079a..ddf868d 100644
--- a/debian/patches/series
+++ b/debian/patches/series
@@ -1,3 +1,4 @@
 01-debian-no-ada-doc.diff
 02-debian-backspace.diff
 03-debian-ncursesconfig-omit-L.diff
+04-strip-trailing-whitespace-in-terminfo.diff
-- 
2.7.0

--- End Message ---
--- Begin Message ---
Source: ncurses
Source-Version: 6.0+20160910-1

We believe that the bug you reported is fixed in the latest version of
ncurses, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 818...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Sven Joachim  (supplier of updated ncurses package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Wed, 14 Sep 2016 20:09:34 +0200
Source: ncurses
Binary: libtinfo5 libtinfo5-udeb libncurses5 libtinfo-dev libtinfo5-dbg 
libncurses5-dev libncurses5-dbg libncursesw5 libncursesw5-dev libncursesw5-dbg 
lib64ncurses5 lib64ncurses5-dev lib32ncurses5 lib32ncurses5-dev lib32ncursesw5 
lib32ncursesw5-dev lib64tinfo5 lib32tinfo5 lib32tinfo-dev ncurses-bin 
ncurses-base ncurses-term ncurses-examples ncurses-doc
Architecture: source
Version: 6.0+20160910-1
Distribution: unstable
Urgency: low
Maintainer: Craig Small 
Changed-By: Sven Joachim 
Description:
 lib32ncurses5 - shared libraries for terminal handling (32-bit)
 lib32ncurses5-dev - developer's libraries for ncurses (32-bit)
 lib32ncursesw5 - shared libraries for terminal handling (wide character 
support) (
 lib32ncursesw5-dev - developer's libraries for ncursesw (32-bit)
 lib32tinfo-dev - developer's library 

Bug#832291: marked as done (bogofilter-{bdb, sqlite, tokyocabinet}: copyright file missing after upgrade (policy 12.5))

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 18:18:41 +
with message-id 
and subject line Bug#832291: fixed in bogofilter 1.2.4+dfsg1-8
has caused the Debian Bug report #832291,
regarding bogofilter-{bdb, sqlite, tokyocabinet}: copyright file missing after 
upgrade (policy 12.5)
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
832291: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=832291
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: bogofilter-bdb,bogofilter-sqlite,bogofilter-tokyocabinet
Version: 1.2.4+dfsg1-6
Severity: serious
User: debian...@lists.debian.org
Usertags: piuparts

Hi,

a test with piuparts revealed that your package misses the copyright
file after an upgrade, which is a violation of Policy 12.5:
https://www.debian.org/doc/debian-policy/ch-docs.html#s-copyrightfile

After the upgrade /usr/share/doc/$PACKAGE/ is just an empty directory.

This was observed on the following upgrade paths:

jessie -> stretch

>From the attached log (scroll to the bottom...):

1m18.5s ERROR: WARN: Inadequate results from running adequate!
  bogofilter-bdb: missing-copyright-file /usr/share/doc/bogofilter-bdb/copyright

  MISSING COPYRIGHT FILE: /usr/share/doc/bogofilter-bdb/copyright
  # ls -lad /usr/share/doc/bogofilter-bdb
  drwxr-xr-x 2 root root 40 Jun 10 11:52 /usr/share/doc/bogofilter-bdb
  # ls -la /usr/share/doc/bogofilter-bdb/
  total 0
  drwxr-xr-x   2 root root   40 Jun 10 11:52 .
  drwxr-xr-x 109 root root 2300 Jun 10 11:52 ..


Additional info may be available here:
https://wiki.debian.org/MissingCopyrightFile

Note that dpkg intentionally does not replace directories with symlinks
and vice versa, you need the maintainer scripts to do this.
See in particular the end of point 4 in
https://www.debian.org/doc/debian-policy/ch-maintainerscripts.html#s-unpackphase

It is recommended to use the dpkg-maintscript-helper commands
'dir_to_symlink' and 'symlink_to_dir' (available since dpkg 1.17.14)
to perform the conversion, ideally using d/$PACKAGE.maintscript.
Do not forget to add 'Pre-Depends: ${misc:Pre-Depends}' in d/control.
See dpkg-maintscript-helper(1) and dh_installdeb(1) for details.


cheers,

Andreas


bogofilter-bdb_1.2.4+dfsg1-6.log.gz
Description: application/gzip
--- End Message ---
--- Begin Message ---
Source: bogofilter
Source-Version: 1.2.4+dfsg1-8

We believe that the bug you reported is fixed in the latest version of
bogofilter, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 832...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Herbert Parentes Fortes Neto  (supplier of updated bogofilter 
package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 14:39:50 -0300
Source: bogofilter
Binary: bogofilter bogofilter-bdb bogofilter-sqlite bogofilter-tokyocabinet 
bogofilter-common
Architecture: source amd64 all
Version: 1.2.4+dfsg1-8
Distribution: unstable
Urgency: medium
Maintainer: Debian QA Group 
Changed-By: Herbert Parentes Fortes Neto 
Description:
 bogofilter - fast Bayesian spam filter (dummy package)
 bogofilter-bdb - fast Bayesian spam filter (Berkeley DB)
 bogofilter-common - fast Bayesian spam filter (common files)
 bogofilter-sqlite - fast Bayesian spam filter (sqlite)
 bogofilter-tokyocabinet - fast Bayesian spam filter (tokyocabinet)
Closes: 832291
Changes:
 bogofilter (1.2.4+dfsg1-8) unstable; urgency=medium
 .
   * QA upload.
   * debian/*.preinst:
   - using dpkg-maintscript-helper. So the file's suffix is .maintscript 
now.
 Packages affected:
   bogofilter and bogofilter-{bdb, sqlite, tokyocabinet}
 Option used: dir_to_symlink
 (Closes: #832291) Thanks Andreas Beckmann and James Cowgill.
Checksums-Sha1:
 7d921c7b1bda1ddb32d06449dbcd3f3f82bdc5e5 2260 bogofilter_1.2.4+dfsg1-8.dsc
 45df2c9dba228dcd73a6f49bbcdb993412a2cb87 18952 
bogofilter_1.2.4+dfsg1-8.debian.tar.xz
 29e460f0b2b66ce96b42b284854edf75e90a6cf7 1076184 
bogofilter-bdb-dbgsym_1.2.4+dfsg1-8_amd64.deb
 c63018c3bb7ea2ef01005d69959e9a4996092694 135494 
bogofilter-bdb_1.2.4+dfsg1-8_amd64.deb
 82c070703ebecd555c467d0ab004a565eff09325 212578 
bogofilter-com

Bug#825524: marked as done (liblexical-underscore-perl: FTBFS with Perl 5.24: Can't use global $_ in "my")

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 18:19:21 +
with message-id 
and subject line Bug#825524: fixed in liblexical-underscore-perl 0.003-2
has caused the Debian Bug report #825524,
regarding liblexical-underscore-perl: FTBFS with Perl 5.24: Can't use global $_ 
in "my"
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
825524: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=825524
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: liblexical-underscore-perl
Version: 0.003-1
Severity: important
User: debian-p...@lists.debian.org
Usertags: perl-5.24-transition
Forwarded: https://rt.cpan.org/Public/Bug/Display.html?id=108203

This package fails to build with Perl 5.24 (currently in experimental.)

  Can't use global $_ in "my" at t/01basic.t line 12, near "my $_ "
  Can't use global $_ in "my" at t/01basic.t line 23, near "my $_ "
  Can't use global $_ in "my" at t/01basic.t line 28, near "my $_ "
  Execution of t/01basic.t aborted due to compilation errors.
  # Looks like your test exited with 255 before it could output anything.
 
Quoting perldelta.pod:

  Lexical $_ has been removed
"my $_" was introduced in Perl 5.10, and subsequently caused
much confusion with no obvious solution. In Perl 5.18.0, it was
made experimental on the theory that it would either be removed or
redesigned in a less confusing (but backward-incompatible) way. Over
the following years, no alternatives were proposed. The feature has
now been removed and will fail to compile.

A full build log is available at
  
http://perl.debian.net/rebuild-logs/perl-5.24-throwaway/liblexical-underscore-perl_0.003-1/

-- 
Niko Tyni   nt...@debian.org
--- End Message ---
--- Begin Message ---
Source: liblexical-underscore-perl
Source-Version: 0.003-2

We believe that the bug you reported is fixed in the latest version of
liblexical-underscore-perl, which is due to be installed in the Debian FTP 
archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 825...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Jonas Smedegaard  (supplier of updated 
liblexical-underscore-perl package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 19:55:14 +0200
Source: liblexical-underscore-perl
Binary: liblexical-underscore-perl
Architecture: source
Version: 0.003-2
Distribution: unstable
Urgency: medium
Maintainer: Debian Perl Group 
Changed-By: Jonas Smedegaard 
Description:
 liblexical-underscore-perl - access your caller's lexical underscore
Closes: 825524
Changes:
 liblexical-underscore-perl (0.003-2) unstable; urgency=medium
 .
   * Update watch file:
 + Bump to version 4.
 + Use only MetaCPAN URL.
 + Mention gpb in usage comment.
   * Stop track upstream source with CDBS (use gpb --uscan).
   * Modernize git-buildpackage config: Filter any .git* file.
   * Declare compliance with Debian Policy 3.9.8.
   * Modernize Vcs-Git field: Use https protocol URL.
   * Bump debhelper compatibility level to 9.
   * Add lintian override regarding debhelper 9.
   * Update copyright info:
 + Use License-Grant and License-Reference fields. Thanks to Ben Finney.
 + Extend coverage of packaging to include current year.
   * Add lintian override regarding license in License-Reference field.
 See bug#786450.
   * Add patch 1001 to avoid lexical underscore.
 Closes: Bug#825524. Thanks to Niko Tyni.
   * Build-depend on licensecheck (not devscripts).
Checksums-Sha1:
 64fef146cfa6e00e124ce0eab1b2106e9a733ca9 2150 
liblexical-underscore-perl_0.003-2.dsc
 06dca2c74620b13aed8e9f43fa71da2202f77e57 4548 
liblexical-underscore-perl_0.003-2.debian.tar.xz
Checksums-Sha256:
 44728e56a33ee6c67a4d696151f3158d6322e00dc42a25e1c75ebb8d080b43c5 2150 
liblexical-underscore-perl_0.003-2.dsc
 a9e8de954251c233d8b920a95c0368d23802f15cdcce1f1869bf3582cb6ff251 4548 
liblexical-underscore-perl_0.003-2.debian.tar.xz
Files:
 9747af81f96caf4878f1d540d81f100e 2150 perl optional 
liblexical-underscore-perl_0.003-2.dsc
 9766195ecbc197be1f21412db073556c 4548 perl optional 
liblexical-underscore-perl_0.003-2.debian.tar.xz

-BEGIN PGP SIGNATURE-

iQIcBAEBCAAGBQJX2ZE9AAoJECx8MUbBoAEhO8

Bug#825762: marked as done (libtext-sprintfn-perl: FTBFS with Perl 5.24: t/01-basics.t failure)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 17:51:10 +
with message-id 
and subject line Bug#825762: fixed in libtext-sprintfn-perl 0.08-1
has caused the Debian Bug report #825762,
regarding libtext-sprintfn-perl: FTBFS with Perl 5.24: t/01-basics.t failure
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
825762: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=825762
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: libtext-sprintfn-perl
Version: 0.07-1
Severity: important
User: debian-p...@lists.debian.org
Usertags: perl-5.24-transition
Tags: fixed-upstream
Forwarded: https://rt.cpan.org/Public/Bug/Display.html?id=105989

This package fails to build with Perl 5.24 (currently in experimental.)
This seems to be fixed upstream in 0.08.
  
  #   Failed test '<%*1$.*f> = <4.>'
  #   at t/01-basics.t line 60.
  #  got: '<5.>'
  # expected: '<4.>'
  Invalid conversion in sprintf: "%(" at 
/<>/blib/lib/Text/sprintfn.pm line 69.
  Redundant argument in sprintf at /<>/blib/lib/Text/sprintfn.pm 
line 69.
  # Looks like you failed 1 test of 31.

A full build log is available at
  
http://perl.debian.net/rebuild-logs/perl-5.24-throwaway/libtext-sprintfn-perl_0.07-1/

-- 
Niko Tyni   nt...@debian.org
--- End Message ---
--- Begin Message ---
Source: libtext-sprintfn-perl
Source-Version: 0.08-1

We believe that the bug you reported is fixed in the latest version of
libtext-sprintfn-perl, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 825...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Jonas Smedegaard  (supplier of updated libtext-sprintfn-perl 
package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 19:20:06 +0200
Source: libtext-sprintfn-perl
Binary: libtext-sprintfn-perl
Architecture: source all
Version: 0.08-1
Distribution: unstable
Urgency: medium
Maintainer: Debian Perl Group 
Changed-By: Jonas Smedegaard 
Description:
 libtext-sprintfn-perl - drop-in replacement for sprintf(), with named 
parameter support
Closes: 825762
Changes:
 libtext-sprintfn-perl (0.08-1) unstable; urgency=medium
 .
   [ upstream ]
   * New release.
 Closes: Bug#825762. Thanks to Niko Tyni.
 .
   [ Jonas Smedegaard ]
   * Declare compliance with Debian Policy 3.9.8.
   * Modernize Vcs-Git field: Use https protocol URL.
   * Modernize git-buildpackage config: Filter any .git* file.
   * Update watch file:
 + Bump to version 4.
 + Use only MetaCPAN URL.
 + Tighten to ignore prereleases.
 + Mention gpb in usage comment.
   * Stop track upstream source with CDBS (use gpb --uscan).
   * Update copyright info:
 + Extend coverage of packaging to include current year.
Checksums-Sha1:
 e0b86d7d0624f9bd4cb49768d3cc4246423b54c9 2114 libtext-sprintfn-perl_0.08-1.dsc
 bff81c0806b95b27ddea6b514f922a5dea367f91 17205 
libtext-sprintfn-perl_0.08.orig.tar.gz
 f3f733e6bbc9a254c121dba655f6f4212e62b6cd 3244 
libtext-sprintfn-perl_0.08-1.debian.tar.xz
 5e9dd2c64c09ecc9ff3448ff0789a822ad0ebd8b 13562 
libtext-sprintfn-perl_0.08-1_all.deb
Checksums-Sha256:
 6e02765c3784ade93df0134fb46e869f1b9806a7d6c7b7b59c140466cc5be29a 2114 
libtext-sprintfn-perl_0.08-1.dsc
 2075fb511cd51998739b29a29a5b100983491e6bf9d2f4a1b229374c57a524c0 17205 
libtext-sprintfn-perl_0.08.orig.tar.gz
 18ef933d06702ec19a3016dd4eb01349a7be60b80ff5a4b333b4bfde4b2e68b0 3244 
libtext-sprintfn-perl_0.08-1.debian.tar.xz
 a4aa50395e47d13e03100080e2874de2cbcf6023f4a6d0b3b1d10250959c4c94 13562 
libtext-sprintfn-perl_0.08-1_all.deb
Files:
 23554e574ee83306501c6dd3eba6d501 2114 perl optional 
libtext-sprintfn-perl_0.08-1.dsc
 5833c1348bced06a949fb6ef0cb370da 17205 perl optional 
libtext-sprintfn-perl_0.08.orig.tar.gz
 795539141c7d0eefe2d683c7c19d2138 3244 perl optional 
libtext-sprintfn-perl_0.08-1.debian.tar.xz
 f0bd46ea4ee48a70ef864b5f9a90d155 13562 perl optional 
libtext-sprintfn-perl_0.08-1_all.deb

-BEGIN PGP SIGNATURE-

iQIcBAEBCAAGBQJX2YdaAAoJECx8MUbBoAEhI1cQAJFgoUmIawRuoID98f7o0H6+
Dqa5fx0JL6PVyiE96+pNHNpVJrlzIFr8DNCcM9neb6nvk8X4IeeVgqUvCd/Tu44j
zUSlt15FydNZRdw9W5/Ptb8C1vMxuqyx7vxZAPWboqeMh+1vtos+ncUeNG0P16Fi
nE2uV8

Bug#837791: marked as done (vino: FTBFS: ./configure: line 4067: GNOME_MAINTAINER_MODE_DEFINES: command not found)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 17:54:02 +
with message-id 
and subject line Bug#837791: fixed in vino 3.21.92-2
has caused the Debian Bug report #837791,
regarding vino: FTBFS:  ./configure: line 4067: GNOME_MAINTAINER_MODE_DEFINES: 
command not found
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837791: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837791
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: vino
Version: 3.21.92-1
Severity: serious
Justification: fails to build from source
User: reproducible-bui...@lists.alioth.debian.org
Usertags: ftbfs
X-Debbugs-Cc: reproducible-bui...@lists.alioth.debian.org

Dear Maintainer,

vino fails to build from source in unstable/amd64:

  [..]

  configure:3498: $? = 0
  configure:3505: ./conftest
  configure:3509: $? = 0
  configure:3524: result: no
  configure:3529: checking for suffix of object files
  configure:3551: gcc -c -g -O2 
-fdebug-prefix-map=/home/lamby/temp/cdt.20160914171706.A1Iq1p8Nz0.db.vino/vino-3.21.92=.
 -fPIE -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time 
-D_FORTIFY_SOURCE=2 conftest.c >&5
  configure:3555: $? = 0
  configure:3576: result: o
  configure:3580: checking whether we are using the GNU C compiler
  configure:3599: gcc -c -g -O2 
-fdebug-prefix-map=/home/lamby/temp/cdt.20160914171706.A1Iq1p8Nz0.db.vino/vino-3.21.92=.
 -fPIE -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time 
-D_FORTIFY_SOURCE=2 conftest.c >&5
  configure:3599: $? = 0
  configure:3608: result: yes
  configure:3617: checking whether gcc accepts -g
  configure:3637: gcc -c -g -Wdate-time -D_FORTIFY_SOURCE=2 conftest.c >&5
  configure:3637: $? = 0
  configure:3678: result: yes
  configure:3695: checking for gcc option to accept ISO C89
  configure:3758: gcc  -c -g -O2 
-fdebug-prefix-map=/home/lamby/temp/cdt.20160914171706.A1Iq1p8Nz0.db.vino/vino-3.21.92=.
 -fPIE -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time 
-D_FORTIFY_SOURCE=2 conftest.c >&5
  configure:3758: $? = 0
  configure:3771: result: none needed
  configure:3796: checking whether gcc understands -c and -o together
  configure:3818: gcc -c conftest.c -o conftest2.o
  configure:3821: $? = 0
  configure:3818: gcc -c conftest.c -o conftest2.o
  configure:3821: $? = 0
  configure:3833: result: yes
  configure:3861: checking for style of include used by make
  configure:3889: result: GNU
  configure:3915: checking dependency style of gcc
  configure:4026: result: none
  configure:4045: checking whether to enable maintainer-specific portions of 
Makefiles
  configure:4054: result: no
  
  ##  ##
  ## Cache variables. ##
  ##  ##
  
  ac_cv_c_compiler_gnu=yes
  ac_cv_env_CC_set=
  ac_cv_env_CC_value=
  ac_cv_env_CFLAGS_set=set
  ac_cv_env_CFLAGS_value='-g -O2 
-fdebug-prefix-map=/home/lamby/temp/cdt.20160914171706.A1Iq1p8Nz0.db.vino/vino-3.21.92=.
 -fPIE -fstack-protector-strong -Wformat -Werror=format-security'
  ac_cv_env_CPPFLAGS_set=set
  ac_cv_env_CPPFLAGS_value='-Wdate-time -D_FORTIFY_SOURCE=2'
  ac_cv_env_CPP_set=
  ac_cv_env_CPP_value=
  ac_cv_env_EGG_SMCLIENT_CFLAGS_set=
  ac_cv_env_EGG_SMCLIENT_CFLAGS_value=
  ac_cv_env_EGG_SMCLIENT_LIBS_set=
  ac_cv_env_EGG_SMCLIENT_LIBS_value=
  ac_cv_env_LDFLAGS_set=set
  ac_cv_env_LDFLAGS_value='-fPIE -pie -Wl,-z,relro -Wl,-z,now -Wl,-z,defs 
-Wl,-O1 -Wl,--as-needed'
  ac_cv_env_LIBS_set=
  ac_cv_env_LIBS_value=
  ac_cv_env_LT_SYS_LIBRARY_PATH_set=
  ac_cv_env_LT_SYS_LIBRARY_PATH_value=
  ac_cv_env_PKG_CONFIG_LIBDIR_set=
  ac_cv_env_PKG_CONFIG_LIBDIR_value=
  ac_cv_env_PKG_CONFIG_PATH_set=
  ac_cv_env_PKG_CONFIG_PATH_value=
  ac_cv_env_PKG_CONFIG_set=
  ac_cv_env_PKG_CONFIG_value=
  ac_cv_env_VINO_SERVER_CFLAGS_set=
  ac_cv_env_VINO_SERVER_CFLAGS_value=
  ac_cv_env_VINO_SERVER_LIBS_set=
  ac_cv_env_VINO_SERVER_LIBS_value=
  ac_cv_env_XMKMF_set=
  ac_cv_env_XMKMF_value=
  ac_cv_env_build_alias_set=set
  ac_cv_env_build_alias_value=x86_64-linux-gnu
  ac_cv_env_host_alias_set=
  ac_cv_env_host_alias_value=
  ac_cv_env_target_alias_set=
  ac_cv_env_target_alias_value=
  ac_cv_objext=o
  ac_cv_path_install='/usr/bin/install -c'
  ac_cv_path_mkdir=/bin/mkdir
  ac_cv_prog_AWK=mawk
  ac_cv_prog_ac_ct_CC=gcc
  ac_cv_prog_cc_c89=
  ac_cv_prog_cc_g=yes
  ac_cv_prog_make_make_set=yes
  am_cv_CC_dependencies_compiler_type=none
  am_cv_make_support_nested_variables=yes
  am_cv_prog_cc_c_o=yes
  
  ## - ##
  ## Output variables. ##
  ## - ##
  
  ACLOCAL='${SHELL} 
/home/lamby/temp/cdt.20160914171706.A1Iq1p8Nz0.db.vin

Bug#837121: marked as done (gazebo: please restrict libkido-dev (build-)dependency to architectures where it is available.)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 17:50:16 +
with message-id 
and subject line Bug#837121: fixed in gazebo 7.3.0+dfsg-6
has caused the Debian Bug report #837121,
regarding gazebo: please restrict libkido-dev (build-)dependency to 
architectures where it is available.
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837121: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837121
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---

Package: gazebo
Version: 7.3.0+dfsg-3
Severity: serious
Tags: patch

The most recent version of gazebo added a build-dependency on 
libkido-dev to the source package and added a binary on libkido-dev to 
libgazebo7-dev


No mention of this was made in the changelog and no other changes in the 
upload seem to be related but 
https://anonscm.debian.org/git/debian-science/packages/gazebo.git/commit/?id=80f9a218ccebb32258812afdf1cce6b50ab88126 
indicates this was to add support for a new feature.


libkido-dev is only available on a handful of architectures. As a result 
this new (build-)dependency is blocking the migration of the new version 
of the package (and hence the FTBFS fix) to testing.


The attatched patch restricts the (build-)dependencies on libkido-dev to 
the architectures where it is actually available (amd64, arm64, i386, 
ppc64el and alpha)
diff -Nru gazebo-7.3.0+dfsg/debian/changelog gazebo-7.3.0+dfsg/debian/changelog
--- gazebo-7.3.0+dfsg/debian/changelog  2016-08-31 17:57:53.0 +
+++ gazebo-7.3.0+dfsg/debian/changelog  2016-09-07 15:06:23.0 +
@@ -1,3 +1,10 @@
+gazebo (7.3.0+dfsg-3+rpi1) stretch-staging; urgency=medium
+
+  * Restrict (build-)dependency on libkido-dev to architectures where that 
package
+is actually available (amd64, arm64, i386, ppc64el and alpha). 
+
+ -- Peter Michael Green   Wed, 07 Sep 2016 15:06:23 
+
+
 gazebo (7.3.0+dfsg-3) unstable; urgency=medium
 
   [ Jochen Sprickerhof ]
diff -Nru gazebo-7.3.0+dfsg/debian/control gazebo-7.3.0+dfsg/debian/control
--- gazebo-7.3.0+dfsg/debian/control2016-08-30 22:54:59.0 +
+++ gazebo-7.3.0+dfsg/debian/control2016-09-07 15:06:07.0 +
@@ -45,7 +45,7 @@
libbullet-dev,
libsimbody-dev,
libsimbody-dev (<< 4.0.0),
-   libkido-dev,
+   libkido-dev [amd64 arm64 i386 powerpc alpha],
libgdal-dev,
ruby-ronn,
libgtest-dev
@@ -138,7 +138,7 @@
  libignition-math2-dev,
  libbullet-dev,
  libsimbody-dev,
- libkido-dev,
+ libkido-dev [amd64 arm64 i386 powerpc alpha],
  libgazebo7 (= ${binary:Version}),
  gazebo7-common (= ${source:Version}),
  gazebo7-plugin-base (= ${binary:Version}),
--- End Message ---
--- Begin Message ---
Source: gazebo
Source-Version: 7.3.0+dfsg-6

We believe that the bug you reported is fixed in the latest version of
gazebo, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Jose Luis Rivero  (supplier of updated gazebo 
package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Wed, 14 Sep 2016 17:00:37 +
Source: gazebo
Binary: gazebo7-common gazebo7 libgazebo7 libgazebo7-dev gazebo7-plugin-base 
gazebo7-doc
Architecture: source
Version: 7.3.0+dfsg-6
Distribution: unstable
Urgency: medium
Maintainer: Debian Science Maintainers 

Changed-By: Jose Luis Rivero 
Description:
 gazebo7- Open Source Robotics Simulator - Binaries
 gazebo7-common - Open Source Robotics Simulator - Shared files
 gazebo7-doc - Open Source Robotics Simulator - Documentation
 gazebo7-plugin-base - Open Source Robotics Simulator - base plug-ins
 libgazebo7 - Open Source Robotics Simulator - shared library
 libgazebo7-dev - Open Source Robotics Simulator - Development Files
Closes: 837121
Changes:
 gazebo (7.3.0+dfsg-6) unstable; urgency=medium
 .
   * Fix supported arches in libgazebo7-dev package. Thanks to Graham Inggs
 (Closes: #837121)
Checksums-Sha1:
 2e4345a2085b37b5829e1bc2bad96e3201d5581d 2725 gazebo_7.3.0+dfsg

Bug#799318: marked as done (base: /usr/lib/x86_64-linux-gnu is not FHS-compliant)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 20:00:52 +0200 (CEST)
with message-id 
and subject line Re: base: /usr/lib/x86_64-linux-gnu is not FHS-compliant
has caused the Debian Bug report #799318,
regarding base: /usr/lib/x86_64-linux-gnu is not FHS-compliant
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
799318: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=799318
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: base
Severity: wishlist

Dear Maintainer,

The Linux Filesystem Hierarchy Standard specifies that all platform
libraries must be installed under /usr/lib. See the current FHS standard
document, section 4.6. Subdirectories under /usr/lib are permitted for
individual packages, but not for platforms. Libraries for non-native
platforms should be installed under /usr/lib, i.e. /usr/lib32.

Debian currently has a /usr/lib/x86_64-linux-gnu under which many,
but not all packages install their libraries. Having some packages
install libraries under /usr/lib and other packages install libraries
under /usr/lib/x86_64-linux-gnu creates confusion and makes it
impossible to detect that a library is installed. Because there
is no standard for the platform name (on other distributions,
x86_64 can be detected as x86_64-unknown-gnu by gcc), it is not
possible to create a general method for library detection, and
requires resorting to either hardcoded dir names per distribution
or a brute force search of the filesystem.

Because Debian is currently the base for most of the major distributions,
and the source of their packages, changing this policy should originate
with Debian. Merging the contents of /usr/lib/x86_64-linux-gnu into
/usr/lib is the policy compliant with the FHS and Debian should lead
by this good example.

-- System Information:
Debian Release: 8.2
  APT prefers stable
  APT policy: (500, 'stable')
Architecture: amd64 (x86_64)

Kernel: Linux 3.16.0-4-amd64 (SMP w/1 CPU core)
Locale: LANG=en_US.UTF-8, LC_CTYPE=en_US.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)
--- End Message ---
--- Begin Message ---
Hello.

[ Sorry for all the time you waited before receiving a reply, there are
  not many people answering to bugs in "base", and we really prefer bugs
  about real packages and not this "base" pseudo-package ].

On Thu, 17 Sep 2015, Mike Sharov wrote:

> Package: base
> Severity: wishlist
> 
> Dear Maintainer,
> 
> The Linux Filesystem Hierarchy Standard specifies that all platform
> libraries must be installed under /usr/lib. See the current FHS standard
> document, section 4.6. Subdirectories under /usr/lib are permitted for
> individual packages, but not for platforms. Libraries for non-native
> platforms should be installed under /usr/lib, i.e. /usr/lib32.
> 
> Debian currently has a /usr/lib/x86_64-linux-gnu under which many,
> but not all packages install their libraries.

There is a reason why libraries are put in those platform dependent
places, and it's called "multiarch". You can read about multiarch here:

https://wiki.debian.org/Multiarch

There are a lot of reasons why the new layout is better than the FHS,
so it is very unlikely that we go back to the old way.

You are right that not every package follows the new standard, but
that's because we have not completed the transition to multiarch yet.

> Having some packages
> install libraries under /usr/lib and other packages install libraries
> under /usr/lib/x86_64-linux-gnu creates confusion and makes it
> impossible to detect that a library is installed.

This is generally not a problem because whenever a package needs a
library, it has a Depends on the package containing the library, so
"apt-get install foo" takes care of installing everything which is
necessary for "foo" to work.

(But I guess that your problem is not a Debian package, but something
that you want to make it work on several different platforms).

> Because there
> is no standard for the platform name (on other distributions,
> x86_64 can be detected as x86_64-unknown-gnu by gcc), it is not
> possible to create a general method for library detection, and
> requires resorting to either hardcoded dir names per distribution
> or a brute force search of the filesystem.
> 
> Because Debian is currently the base for most of the major distributions,
> and the source of their packages, changing this policy should originate
> with Debian. Merging the contents of /usr/lib/x86_64-linux-gnu into
> /usr/lib is the policy compliant with the FHS and Debian should lead
> by this good example.

As I said before,

Bug#782327: marked as done ("/etc/inittab" seems to be disabled due to the switch to systemd, but does not make this clear)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 19:30:02 +0200 (CEST)
with message-id 
and subject line Re: "/etc/inittab" seems to be disabled due to the switch to 
systemd, but does not make this clear
has caused the Debian Bug report #782327,
regarding "/etc/inittab" seems to be disabled due to the switch to systemd, but 
does not make this clear
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
782327: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=782327
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: base
Version: 8
Severity: minor

I installed Debian recently using the stable DVD, not installing the
GUI desktop option. I then set APT to use Testing, ran apt-get update,
dist-upgrade, and installed cinnamon. I noticed than, although logging
in at the command-line and typing startx allowed me to log in to the
GUI, adding "sx:45:once:/bin/su -c /usr/bin/startx -l bateman" to
/etc/inittab and setting the run-level to 5 with "id:5:initdefault:"
did not automatically start the GUI at boot.

I asked at 
http://unix.stackexchange.com/questions/194625/startx-does-not-run-in-etc-inittab
for advice, and I was first advised that the reason this didn't work
was because I was not logged in at the console, and therefore did not
have permission to run startx. I then asked why nothing I did to
/etc/inittab seemed to have any effect, since I'd tried changes like
setting the tty1 command to

1:2345:respawn:/sbin/getty -a bateman 38400 tty1

and commenting out entirely

3:2345:respawn:/sbin/getty 38400 tty3

and didn't notice anything happening. I was told that it was because
Jessie uses systemd, not SysV init, and therefore "some or all of
inittab may not be used". If this is correct, please could a note be
added at the top of /etc/inittab, indicating that it is [partially]
disabled?

/etc/os-release gives
PRETTY_NAME="Debian GNU/Linux 8 (jessie)"
NAME="Debian GNU/Linux"
VERSION_ID="8"
VERSION="8 (jessie)"
ID=debian
HOME_URL="http://www.debian.org/";
SUPPORT_URL="http://www.debian.org/support/";
BUG_REPORT_URL="https://bugs.debian.org/";
--- End Message ---
--- Begin Message ---
On Fri, 10 Apr 2015, George Bateman wrote:

> Package: base
> Version: 8
> Severity: minor
> 
> I installed Debian recently using the stable DVD, not installing the
> GUI desktop option. I then set APT to use Testing, ran apt-get update,
> dist-upgrade, and installed cinnamon. I noticed than, although logging
> in at the command-line and typing startx allowed me to log in to the
> GUI, adding "sx:45:once:/bin/su -c /usr/bin/startx -l bateman" to
> /etc/inittab and setting the run-level to 5 with "id:5:initdefault:"
> did not automatically start the GUI at boot.
> 
> I asked at 
> http://unix.stackexchange.com/questions/194625/startx-does-not-run-in-etc-inittab
> for advice, and I was first advised that the reason this didn't work
> was because I was not logged in at the console, and therefore did not
> have permission to run startx. I then asked why nothing I did to
> /etc/inittab seemed to have any effect, since I'd tried changes like
> setting the tty1 command to
> 
> 1:2345:respawn:/sbin/getty -a bateman 38400 tty1
> 
> and commenting out entirely
> 
> 3:2345:respawn:/sbin/getty 38400 tty3
> 
> and didn't notice anything happening. I was told that it was because
> Jessie uses systemd, not SysV init, and therefore "some or all of
> inittab may not be used". If this is correct, please could a note be
> added at the top of /etc/inittab, indicating that it is [partially]
> disabled?

Hello.

[ Sorry for all the time you waited before receiving a reply, there are
  not many people answering to bugs in "base", and we really prefer bugs
  regarding real packages ].

That's a interesting suggestion, but there are some practical problems
that make it not really feasible:

In Debian 8, systemd is the default init system, but sysvinit is still
available for those who still want to use Debian 8 with sysvinit.

So if we add a note saying that the file is disabled, users of
sysvinit would be greatly confused by the note, because the note would
not say the truth, as the file would still work.

You may ask, then: why can't we put a note in the file *only* when the
file is not being used? There are several problems with that:

* In the first place, we don't really know if the file is used or not!
You can have systemd and sysvinit installed at the same time, and choose
one or another at boot time by having different menu entries in GRUB.

* In the second place, the note would probably have to be added by
systemd, but /etc/inittab is a config

Bug#811467: marked as done (base: a user could delete created root files created in folder where user have access)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 18:57:22 +0200 (CEST)
with message-id 
and subject line Re: base: a user could delete created root files created in 
folder where user have access
has caused the Debian Bug report #811467,
regarding base: a user could delete created root files created in folder where 
user have access
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
811467: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=811467
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: base
Severity: important

Dear Maintainer,

*** Reporter, please consider answering these questions, where appropriate ***

   * What led up to the situation?

Trying to create files with root in user home folder.
But the user could delete the file

   * What exactly did you do (or not do) that was effective (or
 ineffective)?

root creating file
user login, try to delete, it works

teilnehmer@debPc:~$ su
Password:
root@debPc:/home/teilnehmer# clear
root@debPc:/home/teilnehmer# uname -a
Linux debPc 3.16.0-4-amd64 #1 SMP Debian 3.16.7-ckt11-1+deb8u6 (2015-11-09) 
x86_

 64 GNU/Linux
root@debPc:/home/teilnehmer# touch rootfile
root@debPc:/home/teilnehmer# ls -lisa
total 24
266911 4 drwxr-xr-x 2 teilnehmer teilnehmer 4096 Jan 19 10:54 .
258067 4 drwxr-xr-x 4 root   root   4096 Sep 12 10:25 ..
266915 4 -rw--- 1 teilnehmer teilnehmer   46 Jan 14 15:44 .bash_history
266913 4 -rw-r--r-- 1 teilnehmer teilnehmer  220 Nov 13  2014 .bash_logout
266912 4 -rw-r--r-- 1 teilnehmer teilnehmer 3515 Nov 13  2014 .bashrc
266914 4 -rw-r--r-- 1 teilnehmer teilnehmer  675 Nov 13  2014 .profile
267322 0 -rw-r--r-- 1 root   root  0 Jan 19 10:54 rootfile
root@debPc:/home/teilnehmer# exit
exit
teilnehmer@debPc:~$ ls -lisa
total 24
266911 4 drwxr-xr-x 2 teilnehmer teilnehmer 4096 Jan 19 10:54 .
258067 4 drwxr-xr-x 4 root   root   4096 Sep 12 10:25 ..
266915 4 -rw--- 1 teilnehmer teilnehmer   46 Jan 14 15:44 .bash_history
266913 4 -rw-r--r-- 1 teilnehmer teilnehmer  220 Nov 13  2014 .bash_logout
266912 4 -rw-r--r-- 1 teilnehmer teilnehmer 3515 Nov 13  2014 .bashrc
266914 4 -rw-r--r-- 1 teilnehmer teilnehmer  675 Nov 13  2014 .profile
267322 0 -rw-r--r-- 1 root   root  0 Jan 19 10:54 rootfile
teilnehmer@debPc:~$ rm rootfile
rm: remove write-protected regular empty file 'rootfile'? y
teilnehmer@debPc:~$ ls -lisa
total 24
266911 4 drwxr-xr-x 2 teilnehmer teilnehmer 4096 Jan 19 10:54 .
258067 4 drwxr-xr-x 4 root   root   4096 Sep 12 10:25 ..
266915 4 -rw--- 1 teilnehmer teilnehmer   46 Jan 14 15:44 .bash_history
266913 4 -rw-r--r-- 1 teilnehmer teilnehmer  220 Nov 13  2014 .bash_logout
266912 4 -rw-r--r-- 1 teilnehmer teilnehmer 3515 Nov 13  2014 .bashrc
266914 4 -rw-r--r-- 1 teilnehmer teilnehmer  675 Nov 13  2014 .profile
teilnehmer@debPc:~$ id
uid=1001(teilnehmer) gid=1001(teilnehmer) groups=1001(teilnehmer)
teilnehmer@debPc:~$ cat /etc/passwd | grep teilnehmer
teilnehmer:x:1001:1001::/home/teilnehmer:/bin/bash
teilnehmer@debPc:~$ su
Password:
root@debPc:/home/teilnehmer# id
uid=0(root) gid=0(root) groups=0(root)


   * What was the outcome of this action?

the only way was to create a folder with root, move the file there, 
then I could not delete this file with user.
So I believe the folder rights where pushed to files inside.

   * What outcome did you expect instead?
I expect that a normal user could not delete a root create file
*** End of the template - remove these template lines ***


-- System Information:
Debian Release: 8.2
  APT prefers stable-updates
  APT policy: (500, 'stable-updates'), (500, 'stable')
Architecture: amd64 (x86_64)

Kernel: Linux 3.16.0-4-amd64 (SMP w/2 CPU cores)
Locale: LANG=C, LC_CTYPE=C (charmap=ANSI_X3.4-1968)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)
--- End Message ---
--- Begin Message ---
On Tue, 19 Jan 2016, Malte Kiefer wrote:

> Package: base
> Severity: important
> 
> Dear Maintainer,
> 
> *** Reporter, please consider answering these questions, where appropriate ***
> 
>* What led up to the situation?
> 
>   Trying to create files with root in user home folder.
>   But the user could delete the file
> 
>* What exactly did you do (or not do) that was effective (or
>  ineffective)?
> 
>   root creating file
>   user login, try to delete, it works
> [..

Bug#837479: marked as done (Not supported use of UNIVERSAL in bins_edit)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 18:45:19 +0200
with message-id 
and subject line Re: Bug#837479: Not supported use of UNIVERSAL in bins_edit
has caused the Debian Bug report #837479,
regarding Not supported use of UNIVERSAL in bins_edit
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837479: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837479
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: bins
Version: 1.1.29-16
Severity: normal
Tags: patch

   > /usr/bin/bins_edit 
   UNIVERSAL does not export anything at /usr/bin/bins_edit line 29.
   BEGIN failed--compilation aborted at /usr/bin/bins_edit line 29.

The attached patch solves that problem.

-- System Information:
Debian Release: stretch/sid
  APT prefers unstable
  APT policy: (500, 'unstable'), (500, 'testing'), (1, 'experimental')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.5.7 (SMP w/8 CPU cores)
Locale: LANG=de_DE, LC_CTYPE=de_DE (charmap=ISO-8859-1)
Shell: /bin/sh linked to /bin/dash
Init: sysvinit (via /sbin/init)

Versions of packages bins depends on:
ii  libhtml-clean-perl   0.8-12
ii  libhtml-parser-perl  3.72-2
ii  libhtml-template-perl2.95-2
ii  libimage-info-perl   1.28-1.2
ii  libimage-magick-perl [perlmagick]8:6.8.9.9-7.2
ii  libimage-size-perl   3.300-1
ii  libio-string-perl1.08-3
ii  libjpeg-turbo-progs [libjpeg-progs]  1:1.5.0-1
ii  liblocale-gettext-perl   1.07-3
ii  libtext-iconv-perl   1.7-5+b3
ii  libtext-unaccent-perl1.08-1.2
ii  libtimedate-perl 2.3000-2
ii  liburi-perl  1.71-1
ii  libxml-grove-perl0.46alpha-12
ii  libxml-handler-yawriter-perl 0.23-6
ii  libxml-perl  0.08-2
ii  libxml-writer-perl   0.625-1
ii  libxml-xql-perl  0.68-6
ii  perlmagick   8:6.8.9.9-7.2

bins recommends no packages.

bins suggests no packages.

-- no debconf information

-- 
Klaus Ethgen   http://www.ethgen.ch/
pub  4096R/4E20AF1C 2011-05-16Klaus Ethgen 
Fingerprint: 85D4 CA42 952C 949B 1753  62B3 79D0 B06F 4E20 AF1C
--- /usr/bin/bins_edit  2012-08-21 22:23:45.0 +0100
+++ bins_edit   2016-09-11 23:00:59.857022599 +0100
@@ -26,7 +26,6 @@
 
 use Getopt::Long;
 use IO::File;
-use UNIVERSAL qw(isa);
 
 # XML parsing & writing
 use XML::Grove;
@@ -198,7 +197,7 @@
   my $fieldValue;
   foreach my $element
 (@{$document->at_path('/'.$fileType.'/description')->{Contents}}) {
-  if (isa($element, 'XML::Grove::Element') && $element->{Name} eq "field") 
{
+  if ($element->isa('XML::Grove::Element') && $element->{Name} eq "field") 
{
$fieldName = $element->{Attributes}{'name'};
$fieldValue = "";
if ($fieldName eq $field) {


signature.asc
Description: PGP signature
--- End Message ---
--- Begin Message ---

Hello,

Le 12/09/2016 à 00:12, Klaus Ethgen a écrit :

Package: bins
Version: 1.1.29-16
Severity: normal
Tags: patch

   > /usr/bin/bins_edit
   UNIVERSAL does not export anything at /usr/bin/bins_edit line 29.
   BEGIN failed--compilation aborted at /usr/bin/bins_edit line 29.

The attached patch solves that problem.


Thank you for the patch.

bins has been removed from Debian unstable and is no more maintained.
No new version of bins will be available (from Debian).

Regards,

--
 Dr. Ludovic Rousseau--- End Message ---


Bug#837792: marked as done (RFS: python-hdf5storage/0.1.14-1)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 16:40:20 + (UTC)
with message-id <935688972.2003560.1473871220...@mail.yahoo.com>
and subject line Re: Bug#837792: RFS: python-hdf5storage/0.1.14-1
has caused the Debian Bug report #837792,
regarding RFS: python-hdf5storage/0.1.14-1
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837792: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837792
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---

Package: sponsorship-requests
Severity: important

Dear mentors,

I am looking for a sponsor for my package "python-hdf5storage"

* Package name: python-hdf5storage
  Version : 0.1.14-1
  Upstream Author : Freja Nordsiek 
* URL : https://github.com/frejanordsiek/hdf5storage
* License : BSD
  Section : python

It builds those binary packages:

  python-hdf5storage - high-level utilities to read from and write to 
HDF5 (Python 2)

  python-hdf5storage-doc - documentation for hdf5storage
  python3-hdf5storage - high-level utilities to read from and write to 
HDF5 (Python 3)


The packaging repository can be checked out at:


https://anonscm.debian.org/git/debian-science/packages/python-hdf5storage.git

Successful build(s) on debomatic:


http://debomatic-amd64.debian.net/distribution#unstable/python-hdf5storage/0.1.14-1/buildlog

http://debomatic-i386.debian.net/distribution#unstable/python-hdf5storage/0.1.14-1/buildlog

Changes since the last upload:

  * New upstream release.
  * Remove extra arguments for nose.
  * Simplify the packaging testsuite.

Regards,
Ghislain Vaillant
--- End Message ---
--- Begin Message ---
Hi,

>I am looking for a sponsor for my package "python-hdf5storage"

done

G.--- End Message ---


Bug#837704: marked as done (RFS: usbguard/0.5.14+ds1-2)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 16:33:35 +
with message-id 
and subject line closing RFS: usbguard/0.5.14+ds1-2
has caused the Debian Bug report #837704,
regarding RFS: usbguard/0.5.14+ds1-2
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837704: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837704
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: sponsorship-requests
Severity: normal

Dear mentors,

because there is still some stuff to sort out with the new usbguard 0.6
release, i fixed the bugs in the already uploaded release and made a new
debian revision. I hope that approach is oke.

I am looking for a sponsor for my package "usbguard"

 * Package name: usbguard
   Version : 0.5.14+ds1-2
   Upstream Author : Daniel Kopeček 
 * URL : https://github.com/dkopecek/usbguard
 * License : GPL-2+
   Section : utils

  It builds those binary packages:

 libusbguard-dev - USB device authorization policy framework -
development files
 libusbguard0 - USB device authorization policy framework - shared library
 usbguard   - USB device authorization policy framework
 usbguard-applet-qt - USB device authorization policy framework - qt applet

To access further information about this package, please visit the
following URL:

  https://mentors.debian.net/package/usbguard


Alternatively, one can download the package with dget using this command:

dget -x
https://mentors.debian.net/debian/pool/main/u/usbguard/usbguard_0.5.14+ds1-2.dsc

More information about usbguard can be obtained from
https://dkopecek.github.io/usbguard/

  Changes since the last upload:

  * d/control:
   - Add systemd to build dependencies (Closes: #836713)
   - Change architectures to linux-any in d/control
  * d/rules
   - Add sysconfdir flag to autoconf (Closes: #837176)
  * d/patches/
   - Fix mips build (Closes: #836712)
   - Set correct IPCAllowedGroups (Closes: #837175)

cheers,
-- 
muri




signature.asc
Description: OpenPGP digital signature
--- End Message ---
--- Begin Message ---
Package usbguard version 0.5.14+ds1-2 is in unstable now.
https://packages.qa.debian.org/usbguard--- End Message ---


Bug#836659: marked as done (units-filter: please drop the build dependency on hardening-wrapper)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 16:30:33 +
with message-id 
and subject line Bug#836659: fixed in units-filter 3.7-2
has caused the Debian Bug report #836659,
regarding units-filter: please drop the build dependency on hardening-wrapper
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
836659: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836659
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: units-filter
Version: 3.7-1
Severity: important
Tags: sid stretch
User: debian-...@lists.debian.org
Usertags: hardening-wrapper

This package builds using the hardening-wrapper package, which
is now replaced by dpkg-dev's DEB_BUILD_MAINT_OPTIONS settings.

Please consider dropping the build dependency of hardening-wrapper
and use the DEB_BUILD_MAINT_OPTIONS settings.

The goal is to remove hardening-wrapper for the stretch release.
Discussion about the removal is tracked in https://bugs.debian.org/836162

The severity of this report is likely to be raised before the release,
so that the hardening-wrapper package can be removed for the release.
--- End Message ---
--- Begin Message ---
Source: units-filter
Source-Version: 3.7-2

We believe that the bug you reported is fixed in the latest version of
units-filter, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 836...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Georges Khaznadar  (supplier of updated units-filter 
package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 15:50:13 +0200
Source: units-filter
Binary: units-filter
Architecture: source amd64
Version: 3.7-2
Distribution: unstable
Urgency: medium
Maintainer: Georges Khaznadar 
Changed-By: Georges Khaznadar 
Description:
 units-filter - Parser for expressions concerning physical values
Closes: 836659
Changes:
 units-filter (3.7-2) unstable; urgency=medium
 .
   * dropped the dependency on hardening-wrapper. Closes: #836659
   * upgraded Standards-Version to 3.9.8
Checksums-Sha1:
 097d37cad7191b0760b334a3159d2b042297e724 1730 units-filter_3.7-2.dsc
 2c720f97c720d22089838e4eb2d3f9fc80dabc86 4608 units-filter_3.7-2.debian.tar.xz
 a99694fd4f67e7b152bd163ed144add9238cc3a6 127146 
units-filter-dbgsym_3.7-2_amd64.deb
 4988d53616a4ca7c7053c2c6bcbcb85cf4edacc8 31282 units-filter_3.7-2_amd64.deb
Checksums-Sha256:
 8924886ff25fb906c4206d67cee9c329a9644cb4f7eddc793834ada026de1bee 1730 
units-filter_3.7-2.dsc
 18c9cdff943289f12f16b3c21346a24635812c920c164ecca6f23dd44e0c979e 4608 
units-filter_3.7-2.debian.tar.xz
 2c6c49a240afdcdacbc499b46801212555f1e42dba8af3dba16b033a52167f2c 127146 
units-filter-dbgsym_3.7-2_amd64.deb
 506d8f70d3f5fbe1eca61f5100c1a57a3afdbca7dcd8b475e495c54122044047 31282 
units-filter_3.7-2_amd64.deb
Files:
 be387dfcd96ff50b0d209362697c4cf5 1730 science optional units-filter_3.7-2.dsc
 e2fa8917facf4572667fba7fc4649037 4608 science optional 
units-filter_3.7-2.debian.tar.xz
 25536f5efd71b2f7f86206ac2e90f8b5 127146 debug extra 
units-filter-dbgsym_3.7-2_amd64.deb
 55bb29a55ba12ba161e4f94f8577256d 31282 science optional 
units-filter_3.7-2_amd64.deb

-BEGIN PGP SIGNATURE-
Version: GnuPG v1

iQIVAwUBV9lXOBwoFpBxNq45AQhN4A//W5JQAE8BtGzT5znTAiEjBdG0MaX90txl
pdtNeK8fOqF9K6656vC/nVd8cPAo37Xg9I074sVeoO+6gu1tRe4kKWo1nogIh/q7
KR4iX4T5ij+U6nqrGQYLMpWdI5WZ/WlQEE7RrR0f7Xt3DzIbKmS0zgGXPlvAiIRw
qrvtjbTyRqX49x9T74OFLD4opyaZ9v8FQJiyiZjTZmDXtYrNbNv6K3+dcOpIFvCg
KJ2tq/EmsA8AiENW5VwVA8RqX3mkDa4F8V+z6lwJDVqChel3g4vQTmEQTpNun1ae
6jnld6owsugdNZlJ0ha8tW+yrZ5F8njHZnTVXNJSWvrePDaM+/w+RPiIefaWjY87
3Wk/vZZGGyeP3AzjS+h/25+gqf/GpIc3sh/nrjysV6O/jeAEogxwdQGm1YUZm34g
p5w2vnCoq23p8Jya2hLm15axiPeS5GGCZff4FjHpHWLd745nTd7ovrtS/7M0XhGW
UtHh/XNxvgfmQ7e9AuvHWtZ+qhrmaLoF5rgHwDKEEGjodpSb2JC5lA5YJLxQHj5W
rQXzx1W7vq9Jzlz0t37NfhQiGt9dsBf0rAs0kzjuyN5S2PuPUxGPWaQ3ejlvymxv
a+GHBqx8ctgmMEvhoWF154C8HFzvxjiKcg+PjsnTosS/YuO8cx/+MPOE6ifJheR0
vjsnI6UfTys=
=20L2
-END PGP SIGNATURE End Message ---


Bug#835213: marked as done (python-cogent: FTBFS in testing (AssertionError))

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 16:29:41 +
with message-id 
and subject line Bug#835213: fixed in python-cogent 1.9-1
has caused the Debian Bug report #835213,
regarding python-cogent: FTBFS in testing (AssertionError)
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
835213: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=835213
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: src:python-cogent
Version: 1.5.3-10
Severity: serious

Dear maintainer:

I tried to build this package in stretch with "dpkg-buildpackage -A"
(which is what the "Arch: all" autobuilder would do to build it)
but it failed:


[...]
 debian/rules build-indep
dh build-indep --with python2 --buildsystem=pybuild
   dh_testdir -i -O--buildsystem=pybuild
   dh_update_autotools_config -i -O--buildsystem=pybuild
   dh_auto_configure -i -O--buildsystem=pybuild
I: pybuild base:184: python2.7 setup.py config 
running config
   debian/rules override_dh_auto_build
make[1]: Entering directory '/<>'
dh_auto_build
I: pybuild base:184: /usr/bin/python setup.py build 
running build
running build_py

[... snipped ...]

  File "/<>/cogent/util/unit_test.py", line 316, in failUnlessEqual
(msg or 'Got %s, but expected %s' % (`observed`, `expected`))
AssertionError: Got [['cdhit_test_seqs_0'], ['cdhit_test_seqs_1'], 
['cdhit_test_seqs_2'], ['cdhit_test_seqs_3'], ['cdhit_test_seqs_4'], 
['cdhit_test_seqs_5'], ['cdhit_test_seqs_6'], ['cdhit_test_seqs_7'], 
['cdhit_test_seqs_8'], ['cdhit_test_seqs_9']], but expected 
[['cdhit_test_seqs_0'], ['cdhit_test_seqs_1'], ['cdhit_test_seqs_2'], 
['cdhit_test_seqs_3'], ['cdhit_test_seqs_4'], ['cdhit_test_seqs_5'], 
['cdhit_test_seqs_6', 'cdhit_test_seqs_8'], ['cdhit_test_seqs_7'], 
['cdhit_test_seqs_9']]

==
FAIL: test_base_command (test_app.test_cd_hit.CD_HIT_Tests)
CD_HIT BaseCommand should return the correct BaseCommand
--
Traceback (most recent call last):
  File "/<>/tests/test_app/test_cd_hit.py", line 25, in 
test_base_command
''.join(['cd "',getcwd(),'/"; ','cdhit']))
  File "/<>/cogent/util/unit_test.py", line 316, in failUnlessEqual
(msg or 'Got %s, but expected %s' % (`observed`, `expected`))
AssertionError: Got 'cd "/<>/tests/"; cd-hit', but expected 'cd 
"/<>/tests/"; cdhit'

==
FAIL: test_cdhit_from_seqs (test_app.test_cd_hit.CD_HIT_Tests)
CD_HIT should return expected seqs
--
Traceback (most recent call last):
  File "/<>/tests/test_app/test_cd_hit.py", line 52, in 
test_cdhit_from_seqs
self.assertEqual(res.toFasta(), protein_expected)
  File "/<>/cogent/util/unit_test.py", line 316, in failUnlessEqual
(msg or 'Got %s, but expected %s' % (`observed`, `expected`))
AssertionError: Got 
'>seq1\nMGNKWSKSWPQVRDRMRRAAPAPAADGVGAVSQDLAKHGAITSSNTAATNDDCAWLEAQTEEEVGFPVRPQVPLRPMTYK\n>seq2\nMGGKWSKSSIVGWSTVRERMRKTPPAADGVGAVSQDLDKHGAVTSSNTAFNNPDCAWLEAQEDEDVGFPVRPQVPLRPT\n>seq3\nMGGKWSKSSIVGWPAIRERMRRARPAADRVGTQPAADGVGAVSQDLARHGAVTSSNTSHNNPDCAWLEAQVGVR\n>seq4\nMGKIWSKSSIVGWPEIRERMRRQRPHEPAVEPAVGVGAASQDLANRGALTTSNTRTNNPTVAWVEAQEEEGEVVRPQ\n>seq6\nMGKIWSKSSLVGWPEIRERIRRQTPEPAVGVGAVSQDLANRGAITTSNTKDNNQTVAWLEAQEEPVRPQVPLRPM\n>seq7\nMGNALRKGKFEGWAAVRERMRRTRTFPESEPCAPGVGQISRELAARGGIPSSHTPQNNESHQEEEVGFPVAPQV\n>seq8\nMGNAWSKSKFAGWSEVRDRMRRSSSDPQQPCAPGVGAVSRELATRGGISSSALAFLDSHKDEDVGFPVRPQVP\n>seq9\nMGNVLGKDKFKGWAAVRERMRKTSSDPDPQPCAPGVGPVSRELSYTPQNNAALAFLESHEDEDVGFPVXPQV',
 but expected 
'>seq1\nMGNKWSKSWPQVRDRMRRAAPAPAADGVGAVSQDLAKHGAITSSNTAATNDDCAWLEAQTEEEVGFPVRPQVPLRPMTYK\n>seq2\nMGGKWSKSSIVGWSTVRERMRKTPPAADGVGAVSQDLDKHGAVTSSNTAFNNPDCAWLEAQEDEDVGFPVRPQVPLRPT\n>seq3\nMGGKWSKSSIVGWPAIRERMRRARPAADRVGTQPAADGVGAVSQDLARHGAVTSSNTSHNNPDCAWLEAQVGVR\n>seq4\nMGKIWSKSSIV
 
GWPEIRERMRRQRPHEPAVEPAVGVGAASQDLANRGALTTSNTRTNNPTVAWVEAQEEEGEVVRPQ\n>seq5\nMGKIWSKSSLVGWPEIRERMRRQTQEPAVEPAVGAGAASQDLANRGAITIRNTRDNNESIAWLEAQEEEFPVRPQV\n>seq7\nMGNALRKGKFEGWAAVRERMRRTRTFPESEPCAPGVGQISRELAARGGIPSSHTPQNNESHQEEEVGFPVAPQV\n>seq8\nMGNAWSKSKFAGWSEVRDRMRRSSSDPQQPCAPGVGAVSRELATRGGISSSALAFLDSHKDEDVGFPVRPQVP\n>seq9\nMGNVLGKDKFKGWAAVRERMRKTSSDPDPQPCAPGVGPVSRELSYTPQNNAALAFLESHEDEDVGFPVXPQV'

==
FAIL: test_changing_working_dir (test_app.test_cd_hit.CD_HIT_Tests)
CD_HIT BaseCommand should cha

Bug#836619: marked as done (cdcover: please drop the build dependency on hardening-wrapper)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 16:19:50 +
with message-id 
and subject line Bug#836619: fixed in cdcover 0.9.1-12
has caused the Debian Bug report #836619,
regarding cdcover: please drop the build dependency on hardening-wrapper
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
836619: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836619
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: cdcover
Version: 0.9.1-11
Severity: important
Tags: sid stretch
User: debian-...@lists.debian.org
Usertags: hardening-wrapper

This package builds using the hardening-wrapper package, which
is now replaced by dpkg-dev's DEB_BUILD_MAINT_OPTIONS settings.

Please consider dropping the build dependency of hardening-wrapper
and use the DEB_BUILD_MAINT_OPTIONS settings.

The goal is to remove hardening-wrapper for the stretch release.
Discussion about the removal is tracked in https://bugs.debian.org/836162

The severity of this report is likely to be raised before the release,
so that the hardening-wrapper package can be removed for the release.
--- End Message ---
--- Begin Message ---
Source: cdcover
Source-Version: 0.9.1-12

We believe that the bug you reported is fixed in the latest version of
cdcover, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 836...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Georges Khaznadar  (supplier of updated cdcover package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 16:00:18 +0200
Source: cdcover
Binary: cdcover
Architecture: source amd64
Version: 0.9.1-12
Distribution: unstable
Urgency: medium
Maintainer: Georges Khaznadar 
Changed-By: Georges Khaznadar 
Description:
 cdcover- Creating Data-CD Covers
Closes: 836619
Changes:
 cdcover (0.9.1-12) unstable; urgency=medium
 .
   * upgraded Standards-Version to 3.9.8
   * dropped the dependency on hardening-wrapper. Closes: #836619
Checksums-Sha1:
 99f0789807ebcdb962ca186c87cacc4b423a65cf 1680 cdcover_0.9.1-12.dsc
 14a2a9e260855bdd84115ed5e1d6adaee505eddc 7932 cdcover_0.9.1-12.debian.tar.xz
 eee71e77c3d91a5a9294d8a34a7c573fb02f1424 88070 
cdcover-dbgsym_0.9.1-12_amd64.deb
 321f0faccb6ac437dc51eef93bd601b4f4dd6bad 23520 cdcover_0.9.1-12_amd64.deb
Checksums-Sha256:
 d641b5f1d263edf0120158d6010c21f068d97d9dda03f7f0f96c265dd182aff1 1680 
cdcover_0.9.1-12.dsc
 4018bbbcad77ebdabfcb55654271d8f7b19ddee94e282e84e3d951bac3eb008d 7932 
cdcover_0.9.1-12.debian.tar.xz
 1c16a5feb2564c8c5f3dd0dd24c25390104d58aeacb89d08323053fcc72d2a25 88070 
cdcover-dbgsym_0.9.1-12_amd64.deb
 65baccde1dae3974f7d3e48109193aea6f954844dcfd79c7bef80363039c0fa7 23520 
cdcover_0.9.1-12_amd64.deb
Files:
 e23c555f939c7dc4e3722bf874281945 1680 text optional cdcover_0.9.1-12.dsc
 da2e45d233714c6a2460bef007a94fb6 7932 text optional 
cdcover_0.9.1-12.debian.tar.xz
 e3635de00ace57d0c30155b6f51e03f3 88070 debug extra 
cdcover-dbgsym_0.9.1-12_amd64.deb
 f9c31122d1597e551b853a87f226e8a7 23520 text optional cdcover_0.9.1-12_amd64.deb

-BEGIN PGP SIGNATURE-
Version: GnuPG v1

iQIVAwUBV9lYghwoFpBxNq45AQiy4hAAmnnFFsDfYsJsHSHhnYBDwHUJH7J+klT2
AI4xOM7RoxvrXlWfmJWFtNYDVokNF4RH6fdmY0guyekHVQGeEXyp/qjKj+trkeTt
18I+ToHoeBIAarTWAZls38cjGJ8B4P+Ckp3+L9BLiOcvHa0inqFryd4ooVaHxNwx
pX3z5N7OHHF+kgdsZfkttavmf9GJEdmaxM6SepUr52ZGQjHEEkqwmECzDmhdhOI3
/lf1c17IwAj9VBzne/ePoGMREcINv7IoK9RMOrNbt0FmiIeeChmHAn5amKgDG5vy
JKTwAGufiisUX58IHVH5B1Bf+IRKura2MjgdHThFHJSI8Ux7fdJ33yeuJR2c8Ii0
x5XDgGPsTfn7yVZWyRdBkUI2qWr/e0EIl9zeVDMm0v0I3BrZU3qDQY8EIXW7M0BE
3jAeCNSwD1Jy+7LGgDy1uIjGxG4WHtTmxg51XO349GvtLBDut02sJ+7f3jOglLN7
8LRQjF1+qnofG48NyZpUVRFOTkFworyuoZEUvzxP8RCzyMLAqBnKH9vo3T5A8kDz
ZxzUu67t5ozuyeBGyBVCr//rqsZzZbw7wG5WKzWVG11pgfXFPgrLzxyBTmYfwg6j
CLOuj5iCRjcXd4goXoD5L2x2e2emWffcOU9zSCExd2P4f7Sq91KsYI1BKsHFBS30
bcCozUH8vFI=
=G1Ab
-END PGP SIGNATURE End Message ---


Bug#837787: marked as done (xul-ext-adblock-plus: AdBlock-Plus is changing to advertising software)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 05:59:18 -1000
with message-id <36b7c914-ffc9-0ac6-7083-65e37aa71...@tilapin.org>
and subject line Re: [Pkg-mozext-maintainers] Bug#837787: xul-ext-adblock-plus: 
AdBlock-Plus is changing to advertising software
has caused the Debian Bug report #837787,
regarding xul-ext-adblock-plus: AdBlock-Plus is changing to advertising software
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837787: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837787
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: xul-ext-adblock-plus
Version: xul-ext-adblock-plus
Severity: normal

Dear Maintainer,

please take a look at AdBlock Plus "Advertising Program" and remove it from
repository if nessesary, because it is a violence of the Debian Software
Guidelines.

https://adblockplus.org/blog/new-acceptable-ads-platform-launches-bringing-
feedback-to-rtb-and-help-to-small-websites



-- System Information:
Debian Release: stretch/sid
  APT prefers testing
  APT policy: (500, 'testing')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.2.6-bulldozer (SMP w/4 CPU cores)
Locale: LANG=de_DE.utf8, LC_CTYPE=de_DE.utf8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages xul-ext-adblock-plus depends on:
ii  icedove1:45.2.0-4+b1
ii  iceweasel  45.3.0esr-1

xul-ext-adblock-plus recommends no packages.

xul-ext-adblock-plus suggests no packages.
--- End Message ---
--- Begin Message ---
Hi,

Le 14/09/2016 à 05:28, Jens Schmidt a écrit :
> Package: xul-ext-adblock-plus

> please take a look at AdBlock Plus "Advertising Program" and remove it

Not enabled by default in Debian AFAICT.



signature.asc
Description: OpenPGP digital signature
--- End Message ---


Bug#834951: marked as done (gnome-shell: Mixed localizations)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:01:58 -0500
with message-id <8737l2r0d5@bolt.d.tiker.net>
and subject line Re: gnome-shell: Mixed localizations
has caused the Debian Bug report #834951,
regarding gnome-shell: Mixed localizations
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
834951: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=834951
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: gnome-shell
Version: 3.20.3-1+b1
Severity: minor

Dear Maintainer,

as of recently, gnome-shell has started interspersing English strings with the
localized strings that I have otherwise set for my system, leading to
bizarre-looking menus like the following:

https://tiker.net/tmp/gnome-shell-mixed-localization.png

Functionally, everything seems unaffected, but it's certainly not fantastic to 
look at.

Thanks for your efforts in maintaining GNOME in Debian!

Andreas

-- System Information:
Debian Release: stretch/sid
  APT prefers testing
  APT policy: (990, 'testing'), (500, 'stable-updates'), (500, 'unstable'), 
(500, 'stable'), (1, 'experimental')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.7.0-rc7-amd64 (SMP w/4 CPU cores)
Locale: LANG=de_DE.UTF-8, LC_CTYPE=de_DE.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages gnome-shell depends on:
ii  dconf-gsettings-backend [gsettings-backend]  0.26.0-1
ii  evolution-data-server3.20.4-2+b1
ii  gir1.2-accountsservice-1.0   0.6.40-3
ii  gir1.2-atspi-2.0 2.20.2-1
ii  gir1.2-caribou-1.0   0.4.21-1
ii  gir1.2-clutter-1.0   1.26.0-2
ii  gir1.2-freedesktop   1.48.0-3
ii  gir1.2-gcr-3 3.20.0-2
ii  gir1.2-gdesktopenums-3.0 3.20.0-3
ii  gir1.2-gdm-1.0   3.20.1-1
ii  gir1.2-glib-2.0  1.48.0-3
ii  gir1.2-gnomebluetooth-1.03.20.0-1
ii  gir1.2-gnomedesktop-3.0  3.20.2-1
ii  gir1.2-gtk-3.0   3.20.7-1
ii  gir1.2-gweather-3.0  3.20.1-1
ii  gir1.2-ibus-1.0  1.5.11-1
ii  gir1.2-mutter-3.03.20.3-2
ii  gir1.2-networkmanager-1.01.2.4-2
ii  gir1.2-nmgtk-1.0 1.2.4-1
ii  gir1.2-pango-1.0 1.40.1-1
ii  gir1.2-polkit-1.00.105-16
ii  gir1.2-soup-2.4  2.54.1-1
ii  gir1.2-telepathyglib-0.120.24.1-1.1
ii  gir1.2-telepathylogger-0.2   0.8.2-1
ii  gir1.2-upowerglib-1.00.99.4-3
ii  gjs  1.45.4-1
ii  gnome-backgrounds3.20-1
ii  gnome-settings-daemon3.20.1-2
ii  gnome-shell-common   3.20.3-1
ii  gsettings-desktop-schemas3.20.0-3
ii  libatk-bridge2.0-0   2.20.1-3
ii  libatk1.0-0  2.20.0-1
ii  libc62.23-4
ii  libcairo21.14.6-1+b1
ii  libcanberra-gtk3-0   0.30-3
ii  libcanberra0 0.30-3
ii  libclutter-1.0-0 1.26.0-2
ii  libcogl-pango20  1.22.0-2
ii  libcogl201.22.0-2
ii  libcroco30.6.11-1
ii  libdbus-glib-1-2 0.106-1
ii  libecal-1.2-19   3.20.4-2+b1
ii  libedataserver-1.2-213.20.4-2+b1
ii  libgcr-base-3-1  3.20.0-2
ii  libgdk-pixbuf2.0-0   2.34.0-1
ii  libgirepository-1.0-11.48.0-3
ii  libgjs0e [libgjs0-libmozjs-24-0] 1.45.4-1
ii  libglib2.0-0 2.48.1-2
ii  libgstreamer1.0-01.8.2-1
ii  libgtk-3-0   3.20.7-1
ii  libical2 2.0.0-0.5+b1
ii  libicu57 57.1-2
ii  libjson-glib-1.0-0   1.2.2-1
ii  libmozjs-24-024.2.0-3.1
ii  libmutter0h  3.20.3-2
ii  libnm-glib

Bug#837743: marked as done (lxc: Segfault (symbol size mismatch) when starting container created with "download" template)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 06:57:12 -0700
with message-id 
and subject line Re: Bug#837743: lxc: Segfault (symbol size mismatch) when 
starting container created with "download" template
has caused the Debian Bug report #837743,
regarding lxc: Segfault (symbol size mismatch) when starting container created 
with "download" template
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837743: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837743
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: lxc
Version: 1:2.0.4-1
Severity: important

I created an unpriviliged Ubuntu (xenial, amd64) container using "lxc-create -n 
foo -t download", and it seemed to complete with no problems. But when I try to 
start this container using "lxc-start -n foo", I get this error:

>lxc-start: Symbol `ns_info' has different size in shared object, consider 
>re-linking
>Segmentation fault

Lxc doesn't provide any more logging information or output, even when I set 
--logpriority to something high. I also tried creating a Debian (sid, amd64) 
container using the download template and got the same error.

-- System Information:
Debian Release: stretch/sid
  APT prefers unstable
  APT policy: (500, 'unstable')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.7.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=en_US.UTF-8, LC_CTYPE=en_US.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages lxc depends on:
ii  init-system-helpers  1.44
ii  libapparmor1 2.10.95-4
ii  libc62.24-2
ii  libcap2  1:2.25-1
ii  liblxc1  1:2.0.4-1
ii  libseccomp2  2.3.1-2
ii  libselinux1  2.5-3
ii  python3  3.5.1-4
pn  python3:any  

Versions of packages lxc recommends:
ii  bridge-utils  1.5-9
ii  cgmanager 0.41-2
ii  debootstrap   1.0.83
ii  dirmngr   2.1.15-2
ii  dnsmasq-base  2.76-4
ii  gnupg 2.1.15-2
ii  iptables  1.6.0-3
ii  libpam-cgfs   2.0.3-1
ii  lxcfs 2.0.3-1
ii  openssl   1.0.2h-1
ii  rsync 3.1.1-3
ii  uidmap1:4.2-3.1

Versions of packages lxc suggests:
ii  apparmor 2.10.95-4
pn  btrfs-tools  
pn  lua5.2   
pn  lvm2 

-- no debconf information
--- End Message ---
--- Begin Message ---

> On Sep 14, 2016, at 05:58, Evgeni Golov  wrote:
> 
> Hi,
> 
> On Wed, Sep 14, 2016 at 03:32:28AM -0700, Michael Gardner wrote:
>> Thanks for looking into this.
>> 
>> How can I debug further? LXC isn't giving me much to go on, so I'm at a loss.
> 
> Well, as every segfault, gdb, but that's pain.
> 
> Can you please provide the output of the following?
> which lxc-start
> ldd $(which lxc-start)
> dpkg -l |grep lxc
> 
> I suspect that you somehow have a broken/old liblxc somewhere.

Ah, you are right of course. There was another version of lxc lurking in my 
$PATH; apparently I'd had to compile it manually some time ago.

Thanks, and sorry for the noise.--- End Message ---


Bug#837738: marked as done (Fails to start, Invalid property: GtkScrolledWindow.propagate-natural-height)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 13:48:46 +
with message-id 
and subject line Bug#837738: fixed in nautilus 3.21.92-2
has caused the Debian Bug report #837738,
regarding Fails to start, Invalid property: 
GtkScrolledWindow.propagate-natural-height
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837738: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837738
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: nautilus
Version: 3.21.92-1
Severity: grave

When running nautilus, one get's

(nautilus:28168): Gtk-CRITICAL **: Error building template class
'NautilusToolbar' for an instance of type 'NautilusToolbar': .:194:52
Invalid property: GtkScrolledWindow.propagate-natural-height
Segmentation fault



-- System Information:
Debian Release: stretch/sid
  APT prefers unstable-debug
  APT policy: (500, 'unstable-debug'), (500, 'unstable'), (200, 'experimental')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.7.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=de_DE.UTF-8, LC_CTYPE=de_DE.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages nautilus depends on:
ii  desktop-file-utils 0.23-1
ii  gsettings-desktop-schemas  3.21.4-2
ii  gvfs   1.29.92-1
ii  libatk1.0-02.21.90-2
ii  libc6  2.24-2
ii  libcairo-gobject2  1.14.6-1+b1
ii  libcairo2  1.14.6-1+b1
ii  libexempi3 2.3.0-2
ii  libexif12  0.6.21-2
ii  libgail-3-03.21.5-3
ii  libgdk-pixbuf2.0-0 2.35.5-1
ii  libglib2.0-0   2.49.7-1
ii  libglib2.0-data2.49.7-1
ii  libgnome-autoar-0-00.1.1-4
ii  libgnome-desktop-3-12  3.21.92-1
ii  libgtk-3-0 3.21.5-3
ii  libnautilus-extension1a3.21.92-1
ii  libpango-1.0-0 1.40.2-1
ii  libselinux12.5-3
ii  libtracker-sparql-1.0-01.9.1-2
ii  libx11-6   2:1.6.3-1
ii  nautilus-data  3.21.92-1
ii  shared-mime-info   1.7-1

Versions of packages nautilus recommends:
ii  gnome-sushi  3.21.91-1
ii  gvfs-backends1.29.92-1
ii  librsvg2-common  2.40.16-1

Versions of packages nautilus suggests:
ii  brasero3.12.1-2
ii  eog3.20.4-1
ii  evince [pdf-viewer]3.21.4-1
ii  okular [pdf-viewer]4:16.04.2-1
ii  totem  3.21.91-1
ii  tracker1.9.1-2
ii  vlc [mp3-decoder]  2.2.4-3+b4
ii  vlc-nox [mp3-decoder]  2.2.4-3+b4
ii  xdg-user-dirs  0.15-2
ii  xpdf [pdf-viewer]  3.04-1+b1

-- no debconf information
--- End Message ---
--- Begin Message ---
Source: nautilus
Source-Version: 3.21.92-2

We believe that the bug you reported is fixed in the latest version of
nautilus, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Michael Biebl  (supplier of updated nautilus package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 15:30:00 +0200
Source: nautilus
Binary: nautilus libnautilus-extension1a libnautilus-extension-dev 
gir1.2-nautilus-3.0 nautilus-data
Architecture: source
Version: 3.21.92-2
Distribution: unstable
Urgency: medium
Maintainer: Debian GNOME Maintainers 

Changed-By: Michael Biebl 
Description:
 gir1.2-nautilus-3.0 - libraries for nautilus components - gir bindings
 libnautilus-extension-dev - libraries for nautilus components - development 
version
 libnautilus-extension1a - libraries for nautilus components - runtime version
 nautilus   - file manager and graphical shell for GNOME
 nautilus-data - data files for nautilus
Closes: 837738
Changes:
 nautilus (3.21.92-2) unstable; urgency=medium
 .
   [ Jeremy Bicha ]
   * Multiarchify
   * Add multiarch_fallback.patch:
 Load extensions from non-multiarch directory too
 .
   [ Laurent Bigonville ]
   * Bump libgtk-3-dev to 3.21.6, nautilus now uses the
 propagate-natural-height property that has been introduced in this version
 of GTK+ (Closes: #837738)
Checks

Processed: closing 628071

2016-09-14 Thread Debian Bug Tracking System
Processing commands for cont...@bugs.debian.org:

> close 628071
Bug #628071 [bash-completion] bash-completion: Add webm to 
/etc/bash_completion.d/mplayer
Marked Bug as done
> thanks
Stopping processing here.

Please contact me if you need assistance.
-- 
628071: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=628071
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems



Bug#806205: marked as done (bconsole should report on clients that have newer version than sd/dir)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 15:21:46 +0200
with message-id <87eg4mliqd@arioch.leonhardt.eu>
and subject line bacula-doc: authentication errors when bacula-fd is newer than 
the director
has caused the Debian Bug report #806205,
regarding bconsole should report on clients that have newer version than sd/dir
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
806205: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=806205
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: bacula-fd
Version: 7.0.5+dfsg-3
Severity: important
Tags: ipv6

Dear Maintainer,

   * What led up to the situation?

Upgrading bacula-fd to . (and then to 7.0.5+dfsg-3) on the
client machines, while the backup server (which runs Debian stable)
still uses 5.2.6+dfsg-9.3 for both bacula-director and bacula-sd.
The server would be really difficult to upgrade, it should really
remain in Debian stable.

Only IPV6 communitation is allowed for bacula between the client and
the server. This may be related to bug #742914 that was precisely
fixed in 7.0.5+dfsg-2.

After this upgrade, I get messages like:

16-Nov 20:13 . JobId 4415: Start Backup JobId 4415,
Job=BackupClient.2015-11-16_20.10.15_44
16-Nov 20:13 . JobId 4415: Using Device "MyStorage"
16-Nov 20:13 -fd JobId 4415: Fatal error: Authorization key
rejected by Storage daemon.
Please see http://www.bacula.org/en/rel-
manual/Bacula_Freque_Asked_Questi.html#SECTION0026 for help.
16-Nov 20:13 . JobId 4415: Fatal error: Bad response to
Storage command: wanted 2000 OK storage
, got 2902 Bad storage

16-Nov 20:13 . JobId 4415: Error: Bacula .
5.2.6 (21Feb12):


Prior to this update, everything went well.

   * What exactly did you do (or not do) that was effective (or
 ineffective)?

Reinstalling previous version from jessie (5.2.6+dfsg-9.3).

   * What was the outcome of this action?

Going back to previous version worked.

   * What outcome did you expect instead?

I would have expected bacula to run regardless of the versions differences
between client and server.



-- System Information:
Debian Release: stretch/sid
  APT prefers unstable
  APT policy: (500, 'unstable'), (500, 'testing'), (1, 'experimental')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.2.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=fr_FR.utf8, LC_CTYPE=fr_FR.utf8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages bacula-fd depends on:
ii  bacula-common  7.0.5+dfsg-3
ii  libacl12.2.52-2
ii  libc6  2.19-22
ii  libcap21:2.24-12
ii  libgcc11:5.2.1-23
ii  liblzo2-2  2.08-1.2
ii  libssl1.0.21.0.2d-3
ii  libstdc++6 5.2.1-23
ii  libwrap0   7.6.q-25
ii  lsb-base   9.20150917
ii  ucf3.0030
ii  zlib1g 1:1.2.8.dfsg-2+b1

bacula-fd recommends no packages.

bacula-fd suggests no packages.

-- no debconf information
--- End Message ---
--- Begin Message ---
Version: 7.4.3-1

It is now clearly documented that a newer file-daemon is not supported
by an older director.--- End Message ---


Bug#837768: marked as done (dpkg error processing package libapache2-mod-php7.0 (--configure))

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 15:03:14 +0200
with message-id 
<1473858194.2721104.725443705.4e5d7...@webmail.messagingengine.com>
and subject line Re: [php-maint] Bug#837768: dpkg error processing package 
libapache2-mod-php7.0 (--configure)
has caused the Debian Bug report #837768,
regarding dpkg error processing package libapache2-mod-php7.0 (--configure)
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837768: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837768
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: libapache2-mod-php7.0 (7.0.10-2+deb.sury.org~trusty+1)Version: 
7.0.10Severity:Important
Error: dpkg: error processing package libapache2-mod-php7.0 (--configure)Ubuntu 
version: 14.04.5 LTS
Through admin login:1. Ran apt-get update and apt-get upgrade2. Disabled xdebug 
in /etc/php/7.0/apache2/php.ini as    xdebug.remote_autostart=0    
xdebug.remote_enable=0    xdebug.profile_enable=0
On running apt-get install libapache2-mod-php7.0 it throws the following  
error.    
dpkg: error processing package libapache2-mod-php7.0 (--configure)subprocess 
installed post-installation script returned error exit status 1dpkg: dependency 
problems prevent configuration of php7.0 --- End Message ---
--- Begin Message ---
This is a Debian bugtracker for packages in Debian, please use
appropriate bug tracker that's linked in the PPA description
(https://github.com/oerdnj/deb.sury.org/issues)

Cheers,
-- 
Ondřej Surý 
Knot DNS (https://www.knot-dns.cz/) – a high-performance DNS server
Knot Resolver (https://www.knot-resolver.cz/) – secure, privacy-aware,
fast DNS(SEC) resolver
Vše pro chleba (https://vseprochleba.cz) – Mouky ze mlýna a potřeby pro
pečení chleba všeho druhu

On Wed, Sep 14, 2016, at 13:58, siddhartha bose wrote:
> Package: libapache2-mod-php7.0 (7.0.10-2+deb.sury.org~trusty+1)Version:
> 7.0.10Severity:Important
> Error: dpkg: error processing package libapache2-mod-php7.0
> (--configure)Ubuntu version: 14.04.5 LTS
> Through admin login:1. Ran apt-get update and apt-get upgrade2. Disabled
> xdebug in /etc/php/7.0/apache2/php.ini as   
> xdebug.remote_autostart=0    xdebug.remote_enable=0   
> xdebug.profile_enable=0
> On running apt-get install libapache2-mod-php7.0 it throws the following 
> error.    
> dpkg: error processing package libapache2-mod-php7.0
> (--configure)subprocess installed post-installation script returned error
> exit status 1dpkg: dependency problems prevent configuration of php7.0 
> ___
> pkg-php-maint mailing list
> pkg-php-ma...@lists.alioth.debian.org
> http://lists.alioth.debian.org/cgi-bin/mailman/listinfo/pkg-php-maint--- End Message ---


Bug#837769: marked as done (gvfs-backends: gvfsd-dnssd and gvfsd-network log errors)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 14:57:24 +0200
with message-id <20160914125724.ga3...@fatal.se>
and subject line Re: gvfs-backends: gvfsd-dnssd and gvfsd-network log errors
has caused the Debian Bug report #837769,
regarding gvfs-backends: gvfsd-dnssd and gvfsd-network log errors
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837769: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837769
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: gvfs-backends
Version: 1.29.91-1
Severity: minor

I get these on the systems logs:

Sep 13 14:59:16 tucano gvfsd-dnssd[6586]: corrupted double-linked list detected
Sep 13 14:59:16 tucano gvfsd-dnssd[6586]: corrupted double-linked list detected
Sep 13 14:59:16 tucano gvfsd-dnssd[6586]: corrupted double-linked list detected
Sep 13 14:59:16 tucano gvfsd-network[6557]: Couldn't create directory monitor 
on smb://x-gnome-default-workgroup/. Error: Operation not supported by backend
Sep 13 14:59:16 tucano gvfsd-network[6557]: Couldn't create directory monitor 
on smb://x-gnome-default-workgroup/. Error: Operation not supported by backend
Sep 13 14:59:16 tucano gvfsd-network[6557]: Couldn't create directory monitor 
on smb://x-gnome-default-workgroup/. Error: Operation not supported by backend


-- System Information:
Debian Release: stretch/sid
  APT prefers testing
  APT policy: (990, 'testing'), (101, 'unstable')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.6.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=en_US.UTF-8, LC_CTYPE=it_IT.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages gvfs-backends depends on:
ii  dconf-gsettings-backend [gsettings-backend]  0.26.0-1
ii  gvfs 1.29.91-1
ii  gvfs-common  1.29.91-1
ii  gvfs-daemons 1.29.91-1
ii  gvfs-libs1.29.91-1
ii  libarchive13 3.2.1-2
ii  libatk1.0-0  2.21.90-2
ii  libavahi-client3 0.6.32-1
ii  libavahi-common3 0.6.32-1
ii  libavahi-glib1   0.6.32-1
ii  libc62.23-5
ii  libcairo-gobject21.14.6-1+b1
ii  libcairo21.14.6-1+b1
ii  libcap2  1:2.25-1
ii  libcdio-cdda10.83-4.2+b1
ii  libcdio-paranoia10.83-4.2+b1
ii  libcdio130.83-4.2+b1
ii  libgcrypt20  1.7.3-1
ii  libgdata22   0.17.5-1
ii  libgdk-pixbuf2.0-0   2.34.0-1
ii  libglib2.0-0 2.49.6-1
ii  libgoa-1.0-0b3.21.91-1
ii  libgphoto2-6 2.5.10-3
ii  libgphoto2-port122.5.10-3
ii  libgtk-3-0   3.21.5-3
ii  libgudev-1.0-0   230-3
ii  libimobiledevice61.2.0+dfsg-3
ii  libjson-glib-1.0-0   1.2.2-1
ii  libmtp9  1.1.12-1
ii  libpango-1.0-0   1.40.2-1
ii  libpangocairo-1.0-0  1.40.2-1
ii  libplist31.12-3.1
ii  libpolkit-gobject-1-00.105-16
ii  libsecret-1-00.18.5-2
ii  libsmbclient 2:4.4.5+dfsg-2
ii  libsoup2.4-1 2.55.90-1
ii  libxml2  2.9.4+dfsg1-1+b1
ii  psmisc   22.21-2.1+b1

Versions of packages gvfs-backends recommends:
ii  gnome-keyring  3.20.0-3

Versions of packages gvfs-backends suggests:
ii  bluez-obexd   5.36-1+b2
ii  samba-common  2:4.4.5+dfsg-2

-- no debconf information
--- End Message ---
--- Begin Message ---
Hello Francesco Potortì.

Thanks for your bug report.

On Wed, Sep 14, 2016 at 02:10:48PM +0200, Francesco Potortì wrote:
> Package: gvfs-backends
> Version: 1.29.91-1
> Severity: minor
> 
> I get these on the systems logs:
> 
> Sep 13 14:59:16 tucano gvfsd-dnssd[6586]: corrupted double-linked list 
> detected
> Sep 13 14:59:16 tucano gvfsd-dnssd[6586]: corrupted double-linked list 
> detected
> Sep 13 14:

Bug#837758: marked as done (gdm3: option "FirstVT" in daemon.conf doesn't work)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 14:38:40 +0200
with message-id <20160914123840.ga3...@fatal.se>
and subject line Re: gdm3: option "FirstVT" in daemon.conf doesn't work
has caused the Debian Bug report #837758,
regarding gdm3: option "FirstVT" in daemon.conf doesn't work
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837758: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837758
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: gdm3
Version: 3.21.90-1
Severity: normal

Dear Maintainer,

My GDM3 always starts in vtl, regardless of which value of
”FirstVT” is set in /etc/gdm3/daemon.conf. And changing
”VTAllocation” to whether ”true” or ”false” doesn't work
eithbr.

Whereas I tried LightDM, which appears to start in vt7
normally.

I just can't figure out if it is actually a bug or just a
misconfiguration, so I hope the maintainer can make a further
test on it.

Regards,
Taoran



-- System Information:
Debian Release: stretch/sid
  APT prefers testing
  APT policy: (990, 'testing'), (500, 'unstable')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 4.7.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=zh_CN.utf8, LC_CTYPE=zh_CN.utf8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages gdm3 depends on:
ii  accountsservice  0.6.40-3
ii  adduser  3.115
ii  dconf-cli0.26.0-1
ii  dconf-gsettings-backend  0.26.0-1
ii  debconf [debconf-2.0]1.5.59
ii  gir1.2-gdm-1.0   3.21.90-1
ii  gnome-session [x-session-manager]3.20.2-1
ii  gnome-session-bin3.20.2-1
ii  gnome-session-flashback [x-session-manager]  3.20.2-1
ii  gnome-settings-daemon3.21.90-2
ii  gnome-shell  3.21.91-2
ii  gnome-terminal [x-terminal-emulator] 3.21.90-3
ii  gsettings-desktop-schemas3.21.4-2
ii  libaccountsservice0  0.6.40-3
ii  libaudit11:2.6.6-1
ii  libc62.23-5
ii  libcanberra-gtk3-0   0.30-3
ii  libcanberra0 0.30-3
ii  libgdk-pixbuf2.0-0   2.34.0-1
ii  libgdm1  3.21.90-1
ii  libglib2.0-0 2.49.6-1
ii  libglib2.0-bin   2.49.6-1
ii  libgtk-3-0   3.21.5-3
ii  libkeyutils1 1.5.9-9
ii  libpam-modules   1.1.8-3.3
ii  libpam-runtime   1.1.8-3.3
ii  libpam-systemd   231-4
ii  libpam0g 1.1.8-3.3
ii  librsvg2-common  2.40.16-1
ii  libselinux1  2.5-3
ii  libsystemd0  231-4
ii  libwrap0 7.6.q-25
ii  libx11-6 2:1.6.3-1
ii  libxau6  1:1.0.8-1
ii  libxdmcp61:1.1.2-1.1
ii  lsb-base 9.20160629
ii  metacity [x-window-manager]  1:3.20.3-1
ii  mutter [x-window-manager]3.21.91-2
ii  policykit-1  0.105-16
ii  ucf  3.0036
ii  x11-common   1:7.7+16
ii  x11-xserver-utils7.7+7

Versions of packages gdm3 recommends:
ii  at-spi2-core2.20.2-1
ii  desktop-base8.0.2
ii  x11-xkb-utils   7.7+3
ii  xserver-xephyr  2:1.18.4-1
ii  xserver-xorg1:7.7+16
ii  zenity  3.20.0-1

Versions of packages gdm3 suggests:
ii  gnome-orca3.20.2-1
ii  libpam-gnome-keyring  3.20.0-3

-- Configuration Files:
/etc/gdm3/daemon.conf changed:
[daemon]
FirstVT=8
AutomaticLoginEnable=True
AutomaticLogin=xtr
[security]
[xdmcp]
[chooser]
[debug]


-- debconf information excluded
--- End Message ---
--- Begin Message ---
Hello Xu Taoran.

On Wed, Sep 14, 2016 at 05:56:11PM +0800, Xu Taoran wrote:
> Package: gdm3
> Version: 3.21.90-1
> Severity: normal
> 
> Dear Maintainer,
> 
> My GDM3 always starts in vtl, regardless of which value of
> ”FirstVT” is set in /etc/gdm3/daemon.conf. And changing
> ”VTAl

Bug#837744: marked as done (gupnp-dlna: FTBFS: usr/bin/ld: cannot find -lgupnp-dlna-gst-2.0)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 12:35:17 +
with message-id 
and subject line Bug#837744: fixed in gupnp-dlna 0.10.5-3
has caused the Debian Bug report #837744,
regarding gupnp-dlna: FTBFS: usr/bin/ld: cannot find -lgupnp-dlna-gst-2.0
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837744: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837744
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: gupnp-dlna
Version: 0.10.5-2
Severity: serious
Justification: fails to build from source
User: reproducible-bui...@lists.alioth.debian.org
Usertags: ftbfs
X-Debbugs-Cc: reproducible-bui...@lists.alioth.debian.org

Dear Maintainer,

gupnp-dlna fails to build from source in unstable/amd64:

  [..]

  test -d "$destdir" || mkdir -p "$destdir"; \
  test -f 
/home/lamby/temp/cdt.20160914082221.fqYsDdkxNi.db.gupnp-dlna/gupnp-dlna-0.10.5/doc/gupnp-dlna-metadata/$file
 && \
  cp -pf 
/home/lamby/temp/cdt.20160914082221.fqYsDdkxNi.db.gupnp-dlna/gupnp-dlna-0.10.5/doc/gupnp-dlna-metadata/$file
 
/home/lamby/temp/cdt.20160914082221.fqYsDdkxNi.db.gupnp-dlna/gupnp-dlna-0.10.5/doc/gupnp-dlna-metadata/$file
 || true; \
  done; \
  fi; \
  fi
  /bin/mkdir -p xml && ( \
echo ""; \
echo "https://bugzilla.gnome.org/enter_bug.cgi?product=gupnp&component=gupnp-dlna\";>";
 \
echo ""; \
echo ""; \
echo ""; \
echo "http://www.gupnp.org/\";>"; \
echo ""; \
  ) > xml/gtkdocentities.ent
  touch setup-build.stamp
  _source_dir='' ; \
  for i in ./../../libgupnp-dlna/metadata ; do \
  _source_dir="${_source_dir} --source-dir=$i" ; \
  done ; \
  gtkdoc-scan --module=gupnp-dlna-metadata --ignore-headers="" ${_source_dir} 
--deprecated-guards="GUPNP_DISABLE_DEPRECATED" 
  if grep -l '^..*$' gupnp-dlna-metadata.types > /dev/null 2>&1 ; then \
  scanobj_options=""; \
  gtkdoc-scangobj 2>&1 --help | grep  >/dev/null "\-\-verbose"; \
  if test "$?" = "0"; then \
  if test "x" = "x1"; then \
  scanobj_options="--verbose"; \
  fi; \
  fi; \
  CC="/bin/bash ../../libtool --tag=CC --mode=compile gcc  
-I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include  
-Wdate-time -D_FORTIFY_SOURCE=2  -g -O2 
-fdebug-prefix-map=/home/lamby/temp/cdt.20160914082221.fqYsDdkxNi.db.gupnp-dlna/gupnp-dlna-0.10.5=.
 -fstack-protector-strong -Wformat -Werror=format-security -g -O0 -g -Wall" 
LD="/bin/bash ../../libtool --tag=CC --mode=link gcc -lgobject-2.0 -lglib-2.0  
-g -O2 
-fdebug-prefix-map=/home/lamby/temp/cdt.20160914082221.fqYsDdkxNi.db.gupnp-dlna/gupnp-dlna-0.10.5=.
 -fstack-protector-strong -Wformat -Werror=format-security -g -O0 -g -Wall  
-Wl,-z,relro" RUN="/bin/bash ../../libtool --mode=execute" CFLAGS="-I../.. -g 
-O2 
-fdebug-prefix-map=/home/lamby/temp/cdt.20160914082221.fqYsDdkxNi.db.gupnp-dlna/gupnp-dlna-0.10.5=.
 -fstack-protector-strong -Wformat -Werror=format-security -g -O0 -g -Wall" 
LDFLAGS="../../libgupnp-dlna/libgupnp-dlna-2.0.la -Wl,-z,relro" \
  gtkdoc-scangobj  $scanobj_options --module=gupnp-dlna-metadata; \
  else \
  for i in gupnp-dlna-metadata.args gupnp-dlna-metadata.hierarchy 
gupnp-dlna-metadata.interfaces gupnp-dlna-metadata.prerequisites 
gupnp-dlna-metadata.signals ; do \
  test -f $i || touch $i ; \
  done \
  fi
  touch scan-build.stamp
  _source_dir='' ; \
  for i in ./../../libgupnp-dlna/metadata ; do \
  _source_dir="${_source_dir} --source-dir=$i" ; \
  done ; \
  gtkdoc-mkdb --module=gupnp-dlna-metadata --output-format=xml 
--expand-content-files="" --main-sgml-file=gupnp-dlna-metadata-docs.sgml 
${_source_dir} --sgml-mode --output-format=xml
  touch sgml-build.stamp
  rm -rf html && mkdir html && \
  mkhtml_options=""; \
  gtkdoc-mkhtml 2>&1 --help | grep  >/dev/null "\-\-verbose"; \
  if test "$?" = "0"; then \
if test "x" = "x1"; then \
  mkhtml_options="$mkhtml_options --verbose"; \
fi; \
  fi; \
  gtkdoc-mkhtml 2>&1 --help | grep  >/dev/null "\-\-path"; \
  if test "$?" = "0"; then \
mkhtml_options="$mkhtml_options 
--path=\"/home/lamby/temp/cdt.20160914082221.fqYsDdkxNi.db.gupnp-dlna/gupnp-dlna-0.10.5/doc/gupnp-dlna-metadata\"";
 \
  fi; \
  cd html && gtkdoc-mkhtml $mkhtml_options  gupnp-dlna-metadata 
../gupnp-dlna-metadata-docs.sgml
  gtkdoc-fixxref --module=gupnp-dlna-metadata --module-dir=html 
--html-dir=/usr/share/gtk-doc/html --extra-dir=/usr/share/gtk-doc/html/gobject 
--extra-dir=/usr/share/gtk-doc/html/glib 
--extra-dir=/usr/share/gtk-doc/html/gmodule --extra-dir=../gup

Bug#828280: marked as done (dcap: FTBFS with openssl 1.1.0)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 12:18:56 +
with message-id 
and subject line Bug#828280: fixed in dcap 2.47.10-2
has caused the Debian Bug report #828280,
regarding dcap: FTBFS with openssl 1.1.0
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
828280: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=828280
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: dcap
Version: 2.47.10-1
Severity: important
Control: block 827061 by -1

Hi,

OpenSSL 1.1.0 is about to released.  During a rebuild of all packages using
OpenSSL this package fail to build.  A log of that build can be found at:
https://breakpoint.cc/openssl-1.1-rebuild-2016-05-29/Attempted/dcap_2.47.10-1_amd64-20160529-1414

On https://wiki.openssl.org/index.php/1.1_API_Changes you can see various of the
reasons why it might fail.  There are also updated man pages at
https://www.openssl.org/docs/manmaster/ that should contain useful information.

There is a libssl-dev package available in experimental that contains a recent
snapshot, I suggest you try building against that to see if everything works.

If you have problems making things work, feel free to contact us.


Kurt
--- End Message ---
--- Begin Message ---
Source: dcap
Source-Version: 2.47.10-2

We believe that the bug you reported is fixed in the latest version of
dcap, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 828...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Mattias Ellert  (supplier of updated dcap package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 13:16:02 +0200
Source: dcap
Binary: dcap libdcap1 dcap-dev dcap-tunnel-gsi dcap-tunnel-krb dcap-tunnel-ssl 
dcap-tunnel-telnet dcap-dbg libdcap-dbg
Architecture: source amd64
Version: 2.47.10-2
Distribution: unstable
Urgency: medium
Maintainer: Mattias Ellert 
Changed-By: Mattias Ellert 
Description:
 dcap   - Client Tools for dCache
 dcap-dbg   - Debug symbols for dcap client tools
 dcap-dev   - Client Development Files for dCache
 dcap-tunnel-gsi - GSI tunnel for dCache
 dcap-tunnel-krb - Kerberos tunnel for dCache
 dcap-tunnel-ssl - SSL tunnel for dCache
 dcap-tunnel-telnet - Telnet tunnel for dCache
 libdcap-dbg - Debug symbols for dcap libraries and plugins
 libdcap1   - Client Libraries for dCache
Closes: 828280
Changes:
 dcap (2.47.10-2) unstable; urgency=medium
 .
   * Backport fixes from upstream (Closes: #828280)
   * Change Maintainer e-mail (fysast → physics)
Checksums-Sha1:
 1feab71a62ca5943f5b75315da4f362e26f00562 2344 dcap_2.47.10-2.dsc
 a996c93a3fcece88beec948bed9c14c009755bae 6600 dcap_2.47.10-2.debian.tar.xz
 616bbc95c6ee217d76f16196322ba7d6e884 19066 dcap-dbg_2.47.10-2_amd64.deb
 73d4d518827c567c76542f2a8d0c9484109282ea 59142 dcap-dev_2.47.10-2_amd64.deb
 087a9b66cc3832a8e87c3bc11c11aa382f6e9b81 11786 
dcap-tunnel-gsi_2.47.10-2_amd64.deb
 06b949693adf6ede7d060bf024f281c3e0225d5f 11862 
dcap-tunnel-krb_2.47.10-2_amd64.deb
 59710cb5e7fd98411c5b22ab8fa9eacdd92837b8 6916 
dcap-tunnel-ssl_2.47.10-2_amd64.deb
 8c99c4d32abee71a3f3162228648fecc1af1ff09 7408 
dcap-tunnel-telnet_2.47.10-2_amd64.deb
 e17ab5e8116d2b25825f9555e7e1847657cd5c54 12362 dcap_2.47.10-2_amd64.deb
 cb4e7a770d72cb8773a96900078e7cab52e363c7 197670 libdcap-dbg_2.47.10-2_amd64.deb
 f8f44b2e3ad234bc4c67e9fdddcea62a860cd3d1 66158 libdcap1_2.47.10-2_amd64.deb
Checksums-Sha256:
 760e829e5822a23fea4c194dffa1e5049984c0cb38b258c75f1fc274851b78f3 2344 
dcap_2.47.10-2.dsc
 4aac93ea5272dfa882dd0217088554d144a7e26ecb03499ca5f8c171c18839cc 6600 
dcap_2.47.10-2.debian.tar.xz
 b547ce3ba57dfbba9644e06390ac105761d8daf08764ec10c5bf4afdfab1793b 19066 
dcap-dbg_2.47.10-2_amd64.deb
 ae0b77a15a1494d53f871cccd9fb3c33f3d4b1c6c0b4c53fe119729d28acf5c2 59142 
dcap-dev_2.47.10-2_amd64.deb
 ced4c054f6a7ccb18bfea11492c2629dbe616f154a5f561ed5ffef80c5b5f5d6 11786 
dcap-tunnel-gsi_2.47.10-2_amd64.deb
 330adc7c4e0e75bdda6f0cee5fd913f9102a4de01abdb854a3f27448e4f00634 11862 
dcap-tunnel-krb_2.47.10-2_amd64.deb
 04dcbb05ad0aac3c9d1f9a45cc75f81cceb5de4baf66896763436232b853e3a9 6916 
dcap-tunnel-ssl_2.47.10-2_amd64.deb
 2b120ce3287d931c2f8e5

Bug#735347: marked as done (Sourceless file)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 11:50:21 +
with message-id 
and subject line Bug#735347: fixed in bacula-doc 7.4.3-1
has caused the Debian Bug report #735347,
regarding Sourceless file
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
735347: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=735347
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: src:bacula-doc
Severity: serious
User: debian...@lists.debian.org
Usertags: source-contains-prebuilt-flash-object
X-Debbugs-CC: ftpmas...@debian.org

I could not find the source of:
   home-page/conferences/T5RrEVAzdM4


Bastien
--- End Message ---
--- Begin Message ---
Source: bacula-doc
Source-Version: 7.4.3-1

We believe that the bug you reported is fixed in the latest version of
bacula-doc, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 735...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Carsten Leonhardt  (supplier of updated bacula-doc package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Wed, 14 Sep 2016 12:56:53 +0200
Source: bacula-doc
Binary: bacula-doc
Architecture: source
Version: 7.4.3-1
Distribution: unstable
Urgency: low
Maintainer: Debian Bacula Team 
Changed-By: Carsten Leonhardt 
Description:
 bacula-doc - Documentation for Bacula
Closes: 735347
Changes:
 bacula-doc (7.4.3-1) unstable; urgency=low
 .
   * New upstream version.
   * Removed inactive uploaders, added myself.
   * Source changed significantly (Closes: #735347).
   * Revamped almost all of debian/*.
Checksums-Sha1:
 ea2f5fe2ea691d0aaff494e2b1c12c8d5008533e 1990 bacula-doc_7.4.3-1.dsc
 cc1b33f99e069256071ebdcce71fc4b603eeb44f 44510956 bacula-doc_7.4.3.orig.tar.bz2
 82a1c0a2172a64d7aa484e4b914363f0ff2ebb6e 11880 bacula-doc_7.4.3-1.debian.tar.xz
Checksums-Sha256:
 60212cf058b4b98556cc58b41857d2e16246fc9ffbeffe9fef740018a48133a3 1990 
bacula-doc_7.4.3-1.dsc
 19d8998f7065fe28433ee5932f786d566205073e5556db84adcb39132881fb59 44510956 
bacula-doc_7.4.3.orig.tar.bz2
 6af99029c5ce38b43c8e040c7e88d533525870094982db6dd87191786e369cc6 11880 
bacula-doc_7.4.3-1.debian.tar.xz
Files:
 b6070cdfae9b4ec03bfbf76850ebdc3d 1990 doc optional bacula-doc_7.4.3-1.dsc
 a97de09e663af20102423f983321520e 44510956 doc optional 
bacula-doc_7.4.3.orig.tar.bz2
 0e8f1c556595849418e7e16dc4355b4b 11880 doc optional 
bacula-doc_7.4.3-1.debian.tar.xz

-BEGIN PGP SIGNATURE-

iQIcBAEBCgAGBQJX2TerAAoJEFbggnbEQhZ0Ez4P/0YVihMiNVu6dKOLDBstvodV
Ld/V7bhV3xX7eA92Qw+Ugc8QxjQBScRzGR53Lb90J2GmOZnKpW04OxVV+antvY1A
Mx82+Tpb928lkmOWAWjOZ+PoN1L+3jXzqdxzrI+QI+HQ4LeVcSdnw4lNg4L5puK6
1yyUUenNXdBenPoQXpujm0O8OL98ye8lDFcPd1OgQ+7zQHKJq044AvHlpO2sUpU1
ep1hZXcQV2/NxwWldPkpwO/MuY6TE9oX8x78RzADtOQvETM3SDGNxl4H29rIFwQl
W9jDJCNwl00waAyJKfRGr1578xqG9XFi/h4eR7G1Rfu2HTgg5zP0ABxFSpDvdXI3
623SsNdxeE2ON/eCUD0gPYuCSgfqlFGl721c56vzcjkVW34GQQQGSkRjn5Sdc8Aw
19/wkSW38Qbql4JqgFTqmmtH6p57eMp5Z0SIUilwobW/gixq5bi4C2iFAnBd8qRq
eShpp6Jd2f71MYB019egnvR49qTamLYRG105DoiSyaU2WCPJfiAYo1nHfIGoaudN
8li0iIEoA73IMzl08GxBtTyqmTyCNH8RTYS+rHh5OSmZZc4byZmWkv7ZAQRs9o0x
ulZfh3o0yXm8xgnTXb0JuMiLtC58+YVxFtUgw/acTEfiPX47QvS3/PmNcXppObPL
fjKrbJap+w4+RlHXBXDX
=WtYz
-END PGP SIGNATURE End Message ---


Bug#837734: marked as done (mutt: tag save duplicates messages)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:39:41 +
with message-id <20160914103940.k2w62yfjemdrw...@cherubino.dyne.org>
and subject line Re: [Pkg-mutt-maintainers] Bug#837734: Bug#837734: mutt: tag 
save duplicates messages
has caused the Debian Bug report #837734,
regarding mutt: tag save duplicates messages
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837734: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837734
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: mutt
Version: 1.7.0-1
Severity: normal

Dear Maintainer,

When I tag one or more messages in my INBOX (Maildir) and save them to
my mbox using the command ';s' and answering '>' as the mailbox to
save them, each tagged message is saved twice. If I save the messages
individually they are not duplicated. This behavior started recently,
I guess when NeoMutt replaced mutt in debian/testing.

Best regards,
Luis


-- Package-specific info:
NeoMutt  (1.7.0)
Copyright (C) 1996-2016 Michael R. Elkins and others.
Mutt comes with ABSOLUTELY NO WARRANTY; for details type `mutt -vv'.
Mutt is free software, and you are welcome to redistribute it
under certain conditions; type `mutt -vv' for details.

System: Linux 4.6.0-1-amd64 (x86_64)
libidn: 1.33 (compiled with 1.33)
hcache backend: tokyocabinet 1.4.48

Compiler:
Using built-in specs.
COLLECT_GCC=gcc
COLLECT_LTO_WRAPPER=/usr/lib/gcc/x86_64-linux-gnu/6/lto-wrapper
Target: x86_64-linux-gnu
Configured with: ../src/configure -v --with-pkgversion='Debian 6.2.0-1' 
--with-bugurl=file:///usr/share/doc/gcc-6/README.Bugs 
--enable-languages=c,ada,c++,java,go,d,fortran,objc,obj-c++ --prefix=/usr 
--program-suffix=-6 --enable-shared --enable-linker-build-id 
--libexecdir=/usr/lib --without-included-gettext --enable-threads=posix 
--libdir=/usr/lib --enable-nls --with-sysroot=/ --enable-clocale=gnu 
--enable-libstdcxx-debug --enable-libstdcxx-time=yes 
--with-default-libstdcxx-abi=new --enable-gnu-unique-object 
--disable-vtable-verify --enable-libmpx --enable-plugin --with-system-zlib 
--disable-browser-plugin --enable-java-awt=gtk --enable-gtk-cairo 
--with-java-home=/usr/lib/jvm/java-1.5.0-gcj-6-amd64/jre --enable-java-home 
--with-jvm-root-dir=/usr/lib/jvm/java-1.5.0-gcj-6-amd64 
--with-jvm-jar-dir=/usr/lib/jvm-exports/java-1.5.0-gcj-6-amd64 
--with-arch-directory=amd64 --with-ecj-jar=/usr/share/java/eclipse-ecj.jar 
--enable-objc-gc --enable-multiarch --with-arch-32=i686 --with-abi=m64 
--with-multilib-list=m32,m64,mx32 --enable-multilib --with-tune=generic 
--enable-checking=release --build=x86_64-linux-gnu --host=x86_64-linux-gnu 
--target=x86_64-linux-gnu
Thread model: posix
gcc version 6.2.0 20160822 (Debian 6.2.0-1) 

Configure options: '--build=x86_64-linux-gnu' '--prefix=/usr' 
'--includedir=\${prefix}/include' '--mandir=\${prefix}/share/man' 
'--infodir=\${prefix}/share/info' '--sysconfdir=/etc' '--localstatedir=/var' 
'--disable-silent-rules' '--libdir=\${prefix}/lib/x86_64-linux-gnu' 
'--libexecdir=\${prefix}/lib/x86_64-linux-gnu' '--disable-maintainer-mode' 
'--disable-dependency-tracking' '--with-mailpath=/var/mail' 
'--enable-compressed' '--enable-debug' '--enable-fcntl' '--enable-hcache' 
'--enable-gpgme' '--enable-imap' '--enable-smtp' '--enable-pop' 
'--enable-sidebar' '--enable-nntp' '--enable-notmuch' '--disable-fmemopen' 
'--with-curses' '--with-gnutls' '--with-gss' '--with-idn' '--with-mixmaster' 
'--with-sasl' '--without-gdbm' '--without-bdb' '--without-qdbm' 
'build_alias=x86_64-linux-gnu' 'CFLAGS=-g -O2 
-fdebug-prefix-map=/build/mutt-wQLglL/mutt-1.7.0=. -fPIE 
-fstack-protector-strong -Wformat -Werror=format-security' 'LDFLAGS=-fPIE -pie 
-Wl,-z,relro -Wl,-z,now' 'CPPFLAGS=-Wdate-time -D_FORTIFY_SOURCE=2'

Compilation CFLAGS: -Wall -pedantic -Wno-long-long -g -O2 
-fdebug-prefix-map=/build/mutt-wQLglL/mutt-1.7.0=. -fPIE 
-fstack-protector-strong -Wformat -Werror=format-security

Compile options:
+CRYPT_BACKEND_CLASSIC_PGP +CRYPT_BACKEND_CLASSIC_SMIME +CRYPT_BACKEND_GPGME 
+DEBUG +DL_STANDALONE +ENABLE_NLS -EXACT_ADDRESS -HOMESPOOL -LOCALES_HACK 
-SUN_ATTACHMENT +HAVE_BKGDSET +HAVE_COLOR +HAVE_CURS_SET +HAVE_GETADDRINFO 
+HAVE_GETSID +HAVE_ICONV +HAVE_LANGINFO_CODESET +HAVE_LANGINFO_YESEXPR 
+HAVE_LIBIDN +HAVE_META +HAVE_REGCOMP +HAVE_RESIZETERM +HAVE_START_COLOR 
+HAVE_TYPEAHEAD +HAVE_WC_FUNCS +ICONV_NONTRANS +USE_COMPRESSED +USE_DOTLOCK 
+USE_FCNTL -USE_FLOCK -USE_FMEMOPEN -USE_GNU_REGEX +USE_GSS +USE_HCACHE 
+USE_IMAP +USE_NOTMUCH +USE_NNTP +USE_POP +USE_SASL +USE_SETGID +USE_SIDEBAR 
+USE_SMTP +USE_SSL_GNUTLS -USE_SSL_OPENSSL 
-DOMAIN
MIXMASTER="mixmaster"

Bug#836712: marked as done (usbguard: FTBFS on mips: __atomic_fetch_add_8 undefined)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:32:36 +
with message-id 
and subject line Bug#836712: fixed in usbguard 0.5.14+ds1-2
has caused the Debian Bug report #836712,
regarding usbguard: FTBFS on mips: __atomic_fetch_add_8 undefined
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
836712: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836712
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: usbguard
Version: 0.5.14+ds1-1
Severity: important
Justification: fails to build from source

The mips build of usbguard failed:

  ./.libs/libusbguard.so: undefined reference to `__atomic_fetch_add_8'
  collect2: error: ld returned 1 exit status
  Makefile:1218: recipe for target 'usbguard' failed
  make[3]: *** [usbguard] Error 1

This symbol comes from -latomic (from libatomic1); you should be able
to avoid a formal dependency on that library on platforms that don't
require it by specifying -Wl,-as-needed -latomic -Wl,-no-as-needed.

Could you please take a look?

Thanks!
--- End Message ---
--- Begin Message ---
Source: usbguard
Source-Version: 0.5.14+ds1-2

We believe that the bug you reported is fixed in the latest version of
usbguard, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 836...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Muri Nicanor  (supplier of updated usbguard package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Tue, 13 Sep 2016 18:39:53 +0200
Source: usbguard
Binary: libusbguard-dev libusbguard0 usbguard usbguard-applet-qt
Architecture: source
Version: 0.5.14+ds1-2
Distribution: unstable
Urgency: medium
Maintainer: Muri Nicanor 
Changed-By: Muri Nicanor 
Description:
 libusbguard-dev - USB device authorization policy framework - development files
 libusbguard0 - USB device authorization policy framework - shared library
 usbguard   - USB device authorization policy framework
 usbguard-applet-qt - USB device authorization policy framework - qt applet
Closes: 836712 836713 837175 837176
Changes:
 usbguard (0.5.14+ds1-2) unstable; urgency=medium
 .
   * d/control:
- Add systemd to build dependencies (Closes: #836713)
- Change architectures to linux-any in d/control
   * d/rules
- Add sysconfdir flag to autoconf (Closes: #837176)
   * d/patches/
- Fix mips build (Closes: #836712)
- Set correct IPCAllowedGroups (Closes: #837175)
Checksums-Sha1:
 a444d7047698c6e9292dfe27b27986a2ca7d9b48 2270 usbguard_0.5.14+ds1-2.dsc
 54d6da684aa81867d26005acb1d075008eeb7f41 16152 
usbguard_0.5.14+ds1-2.debian.tar.xz
Checksums-Sha256:
 35482e0cc24f8633c0ed116bca31414e1a8e410731c53b6ece4678d611ee059a 2270 
usbguard_0.5.14+ds1-2.dsc
 666caf46c13f0600b11e5611c71498ddca18bbe4e66c038c5c4a359c52e90d72 16152 
usbguard_0.5.14+ds1-2.debian.tar.xz
Files:
 170100f4076b667a6c1e1e4f275df3f7 2270 utils optional usbguard_0.5.14+ds1-2.dsc
 0a1f2fc6501da246b7eee364e35c90cf 16152 utils optional 
usbguard_0.5.14+ds1-2.debian.tar.xz

-BEGIN PGP SIGNATURE-
Version: GnuPG v2

iQIcBAEBCAAGBQJX2RMdAAoJEPNPCXROn13ZmMUQAImb+To8jy4RQISfKtqDq4SZ
hwamw2sF5TrEz5pkkPa7ljSWCr/pHXpAqNBnJPvm9qc6l7+yNEH5s49dFHhm13qD
igl1/5hBlKKsdrBqAQ8nItkvGNwWq7Y9aj51q24f/w60u8ORMCfJ2g17gaUX5J4s
af9pbuXNpcyQmF7psv/yRtMz/0sQQKWm4j1pOdMt8Mpgwb5HLOXTI/v0cX0vaMGV
F28yCAcevSF+3fB52rLEYlTp62vsicMr813Os6abNXkyT3CC5o10NG+aI5Kq9cSl
8SwXb9tO6+yl+9QpgFq+9BYCuMQh2623iMPmNwiFRzt2GvOei6df2XVcw4ANYEKI
dio+FHb/wHUR4jsB0bTUoQILNX9Z9lUAZPaS0y/AXERWHVkzKqtrQ6p5oJ2GiXIm
UMtzFuQ9DWHMXEsG4hxBYmvDraLsFfjPywUX2qv4t9yZ4OQNfYy7pXMH5fYU2GSR
jn2JZ93FJHziS1lzQbvqTqcjsc4F0bLyM66LFtkTUogLQZsYfTSJQmEzU5inkuEZ
QWk+1vOngXJzljPF2OpRp+RodSS+dkzjwlqUqK6bzi8XU1lQ90rqtZ7sXV1JKMtx
GksINGwErn1vKDA9HYONCROl3PGZq2QxeRkurxqyWRocuB/PW1v8DCoWlQJVXb2y
wisbQqECgiTuitoYgHKo
=gQ1B
-END PGP SIGNATURE End Message ---


Bug#835648: marked as done (wpasupplicant: suspend takes very long due to problematic system-sleep hook)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:32:55 +
with message-id 
and subject line Bug#835648: fixed in wpa 2.5-2+v2.4-3
has caused the Debian Bug report #835648,
regarding wpasupplicant: suspend takes very long due to problematic 
system-sleep hook
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
835648: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=835648
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wpasupplicant
Version: 2.5-2+v2.4-2
Severity: normal

I recently upgraded the wpasupplicant package and my system started taking a
LONG time to suspend. My journal contains:

Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.2710] manager: 
sleep requested (sleeping: no  enabled: yes)
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.2710] manager: 
sleeping...
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.2711] device 
(eth0): state change: unavailable -> unmanaged (reason 'sleeping') [20 10 37]
Aug 27 23:40:53 notes kernel: e1000e: eth0 NIC Link is Down
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.3941] manager: 
NetworkManager state is now ASLEEP
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.3974] device 
(wlan1): state change: activated -> deactivating (reason 'sleeping') [100 110 
37]
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.4048] device 
(wlan1): state change: deactivating -> disconnected (reason 'sleeping') [110 30 
37]
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.4232] dhcp4 
(wlan1): canceled DHCP transaction, DHCP client pid 18447
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.4233] dhcp4 
(wlan1): state changed bound -> done
Aug 27 23:40:53 notes kernel: wlan1: deauthenticating from c4:27:95:77:a6:b8 by 
local choice (Reason: 3=DEAUTH_LEAVING)
Aug 27 23:40:53 notes wpa_supplicant[2812]: wlan1: CTRL-EVENT-DISCONNECTED 
bssid=c4:27:95:77:a6:b8 reason=3 locally_generated=1
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.4548] dns-mgr: 
Writing DNS information to /sbin/resolvconf
Aug 27 23:40:53 notes wpa_supplicant[2812]: wlan1: CTRL-EVENT-REGDOM-CHANGE 
init=CORE type=WORLD
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.5079] 
sup-iface[0x9947a98,wlan1]: connection disconnected (reason -3)
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.5080] device 
(wlan1): supplicant interface state: completed -> disconnected
Aug 27 23:40:53 notes NetworkManager[1904]:   [1472334053.5091] device 
(wlan1): state change: disconnected -> unmanaged (reason 'sleeping') [30 10 37]
Aug 27 23:40:53 notes systemd[1]: Reached target Sleep.
Aug 27 23:40:53 notes systemd[1]: Starting Suspend...
Aug 27 23:40:54 notes wpa_supplicant[2812]: nl80211: deinit ifname=wlan1 
disabled_11b_rates=0
Aug 27 23:41:04 notes systemd-sleep[18924]: Selected interface 'wlan1'
Aug 27 23:41:04 notes systemd-sleep[18924]: 'SUSPEND' command timed out.
Aug 27 23:41:04 notes systemd-sleep[18928]: 
/lib/systemd/system-sleep/wpasupplicant failed with error code 254.
Aug 27 23:41:04 notes systemd-sleep[18924]: Suspending system...

Disabling the /lib/systemd/system-sleep/wpasupplicant script fixes the problem
for me. From what NetworkManagers prints to the journal it seems to me that
the /lib/systemd/system-sleep/wpasupplicant script is unnecessary, and since
it makes suspend take 10 seconds longer, it is actually not just unnecessary,
but harmful.

I suspend the system by invoking "systemctl suspend" via acpid.

I tried to research this a bit. If I manually invoke

dbus-send --print-reply --system --dest=org.freedesktop.NetworkManager 
/org/freedesktop/NetworkManager org.freedesktop.NetworkManager.Sleep 
boolean:true

and then try to "/sbin/wpa_cli suspend", I always get:

Failed to connect to non-global ctrl_ifname: (nil)  error: No such file or 
directory

Seems to me then that the 10s delay I'm getting is a race condition between NM
sleeping and wpa_cli attempting to suspend. It's also interesting that on my
hardware (ThinkPad T420, Intel(R) Centrino(R) Advanced-N 6205 AGN, REV=0xB0)
wpa_cli suspend does nothing at all -- after invoking it and getting OK, wifi
stays connected and pings.

I also looked into dbus-monitor output and in my case NM drops the inhibitor
only after putting both eth and wlan devices offline, unlike in the launchpad
issue that the /lib/systemd/system-sleep/wpasupplicant is trying to fix.

-- System Information:
Debian Release: stretch/sid
  APT prefers testing
  APT policy: (980, 'testing'), (980, 'stable'), (500, 'unstable-debug'), (500, 
'testing-debug'), (

Bug#836713: marked as done (usbguard: FTBFS: No package 'systemd' found)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:32:36 +
with message-id 
and subject line Bug#836713: fixed in usbguard 0.5.14+ds1-2
has caused the Debian Bug report #836713,
regarding usbguard: FTBFS: No package 'systemd' found
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
836713: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836713
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: usbguard
Version: 0.5.14+ds1-1
Severity: important
Justification: fails to build from source

The hppa build of usbguard failed:

  Package systemd was not found in the pkg-config search path.
  Perhaps you should add the directory containing `systemd.pc'
  to the PKG_CONFIG_PATH environment variable
  No package 'systemd' found
  configure: error: in `/<>/usbguard-0.5.14+ds1':
  configure: error: Cannot detect the systemd system unit dir

AFAICT, systemd.pc comes from the systemd package; please try
declaring a build dependency on it.

Thanks!
--- End Message ---
--- Begin Message ---
Source: usbguard
Source-Version: 0.5.14+ds1-2

We believe that the bug you reported is fixed in the latest version of
usbguard, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 836...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Muri Nicanor  (supplier of updated usbguard package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Tue, 13 Sep 2016 18:39:53 +0200
Source: usbguard
Binary: libusbguard-dev libusbguard0 usbguard usbguard-applet-qt
Architecture: source
Version: 0.5.14+ds1-2
Distribution: unstable
Urgency: medium
Maintainer: Muri Nicanor 
Changed-By: Muri Nicanor 
Description:
 libusbguard-dev - USB device authorization policy framework - development files
 libusbguard0 - USB device authorization policy framework - shared library
 usbguard   - USB device authorization policy framework
 usbguard-applet-qt - USB device authorization policy framework - qt applet
Closes: 836712 836713 837175 837176
Changes:
 usbguard (0.5.14+ds1-2) unstable; urgency=medium
 .
   * d/control:
- Add systemd to build dependencies (Closes: #836713)
- Change architectures to linux-any in d/control
   * d/rules
- Add sysconfdir flag to autoconf (Closes: #837176)
   * d/patches/
- Fix mips build (Closes: #836712)
- Set correct IPCAllowedGroups (Closes: #837175)
Checksums-Sha1:
 a444d7047698c6e9292dfe27b27986a2ca7d9b48 2270 usbguard_0.5.14+ds1-2.dsc
 54d6da684aa81867d26005acb1d075008eeb7f41 16152 
usbguard_0.5.14+ds1-2.debian.tar.xz
Checksums-Sha256:
 35482e0cc24f8633c0ed116bca31414e1a8e410731c53b6ece4678d611ee059a 2270 
usbguard_0.5.14+ds1-2.dsc
 666caf46c13f0600b11e5611c71498ddca18bbe4e66c038c5c4a359c52e90d72 16152 
usbguard_0.5.14+ds1-2.debian.tar.xz
Files:
 170100f4076b667a6c1e1e4f275df3f7 2270 utils optional usbguard_0.5.14+ds1-2.dsc
 0a1f2fc6501da246b7eee364e35c90cf 16152 utils optional 
usbguard_0.5.14+ds1-2.debian.tar.xz

-BEGIN PGP SIGNATURE-
Version: GnuPG v2

iQIcBAEBCAAGBQJX2RMdAAoJEPNPCXROn13ZmMUQAImb+To8jy4RQISfKtqDq4SZ
hwamw2sF5TrEz5pkkPa7ljSWCr/pHXpAqNBnJPvm9qc6l7+yNEH5s49dFHhm13qD
igl1/5hBlKKsdrBqAQ8nItkvGNwWq7Y9aj51q24f/w60u8ORMCfJ2g17gaUX5J4s
af9pbuXNpcyQmF7psv/yRtMz/0sQQKWm4j1pOdMt8Mpgwb5HLOXTI/v0cX0vaMGV
F28yCAcevSF+3fB52rLEYlTp62vsicMr813Os6abNXkyT3CC5o10NG+aI5Kq9cSl
8SwXb9tO6+yl+9QpgFq+9BYCuMQh2623iMPmNwiFRzt2GvOei6df2XVcw4ANYEKI
dio+FHb/wHUR4jsB0bTUoQILNX9Z9lUAZPaS0y/AXERWHVkzKqtrQ6p5oJ2GiXIm
UMtzFuQ9DWHMXEsG4hxBYmvDraLsFfjPywUX2qv4t9yZ4OQNfYy7pXMH5fYU2GSR
jn2JZ93FJHziS1lzQbvqTqcjsc4F0bLyM66LFtkTUogLQZsYfTSJQmEzU5inkuEZ
QWk+1vOngXJzljPF2OpRp+RodSS+dkzjwlqUqK6bzi8XU1lQ90rqtZ7sXV1JKMtx
GksINGwErn1vKDA9HYONCROl3PGZq2QxeRkurxqyWRocuB/PW1v8DCoWlQJVXb2y
wisbQqECgiTuitoYgHKo
=gQ1B
-END PGP SIGNATURE End Message ---


Bug#837175: marked as done (usbguard: don' set IPCAllowedGroups=wheel)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:32:37 +
with message-id 
and subject line Bug#837175: fixed in usbguard 0.5.14+ds1-2
has caused the Debian Bug report #837175,
regarding usbguard: don' set IPCAllowedGroups=wheel
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837175: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837175
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: usbguard
Version: 0.5.14+ds1-1
Severity: important
Tags: security


Hi.

Currently the config sets:
IPCAllowedGroups=wheel

This doesn't seem to be one of the standard Debian
system groups (it doesn't even exist), nor is it created
by the package.
It may very well exist already as some user (thus the security
tag and important).

Please use porper group (I think the upstream docs use "usbguard"
as an example,... or simply use "root" group.


Cheers,
Chris.


-- System Information:
Debian Release: stretch/sid
  APT prefers unstable-debug
  APT policy: (500, 'unstable-debug'), (500, 'unstable')
Architecture: amd64 (x86_64)

Kernel: Linux 4.7.0-1-amd64 (SMP w/8 CPU cores)
Locale: LANG=en_DE.UTF-8, LC_CTYPE=en_DE.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages usbguard depends on:
ii  init-system-helpers  1.42
ii  libc62.24-2
ii  libcap-ng0   0.7.7-3
ii  libdbus-1-3  1.10.10-1
ii  libdbus-glib-1-2 0.106-1
ii  libgcc1  1:6.2.0-3
ii  libglib2.0-0 2.49.6-1
ii  libqb0   1.0-1
ii  libseccomp2  2.3.1-2
ii  libstdc++6   6.2.0-3
ii  libusbguard0 0.5.14+ds1-1

usbguard recommends no packages.

usbguard suggests no packages.

-- no debconf information
--- End Message ---
--- Begin Message ---
Source: usbguard
Source-Version: 0.5.14+ds1-2

We believe that the bug you reported is fixed in the latest version of
usbguard, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Muri Nicanor  (supplier of updated usbguard package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Tue, 13 Sep 2016 18:39:53 +0200
Source: usbguard
Binary: libusbguard-dev libusbguard0 usbguard usbguard-applet-qt
Architecture: source
Version: 0.5.14+ds1-2
Distribution: unstable
Urgency: medium
Maintainer: Muri Nicanor 
Changed-By: Muri Nicanor 
Description:
 libusbguard-dev - USB device authorization policy framework - development files
 libusbguard0 - USB device authorization policy framework - shared library
 usbguard   - USB device authorization policy framework
 usbguard-applet-qt - USB device authorization policy framework - qt applet
Closes: 836712 836713 837175 837176
Changes:
 usbguard (0.5.14+ds1-2) unstable; urgency=medium
 .
   * d/control:
- Add systemd to build dependencies (Closes: #836713)
- Change architectures to linux-any in d/control
   * d/rules
- Add sysconfdir flag to autoconf (Closes: #837176)
   * d/patches/
- Fix mips build (Closes: #836712)
- Set correct IPCAllowedGroups (Closes: #837175)
Checksums-Sha1:
 a444d7047698c6e9292dfe27b27986a2ca7d9b48 2270 usbguard_0.5.14+ds1-2.dsc
 54d6da684aa81867d26005acb1d075008eeb7f41 16152 
usbguard_0.5.14+ds1-2.debian.tar.xz
Checksums-Sha256:
 35482e0cc24f8633c0ed116bca31414e1a8e410731c53b6ece4678d611ee059a 2270 
usbguard_0.5.14+ds1-2.dsc
 666caf46c13f0600b11e5611c71498ddca18bbe4e66c038c5c4a359c52e90d72 16152 
usbguard_0.5.14+ds1-2.debian.tar.xz
Files:
 170100f4076b667a6c1e1e4f275df3f7 2270 utils optional usbguard_0.5.14+ds1-2.dsc
 0a1f2fc6501da246b7eee364e35c90cf 16152 utils optional 
usbguard_0.5.14+ds1-2.debian.tar.xz

-BEGIN PGP SIGNATURE-
Version: GnuPG v2

iQIcBAEBCAAGBQJX2RMdAAoJEPNPCXROn13ZmMUQAImb+To8jy4RQISfKtqDq4SZ
hwamw2sF5TrEz5pkkPa7ljSWCr/pHXpAqNBnJPvm9qc6l7+yNEH5s49dFHhm13qD
igl1/5hBlKKsdrBqAQ8nItkvGNwWq7Y9aj51q24f/w60u8ORMCfJ2g17gaUX5J4s
af9pbuXNpcyQmF7psv/yRtMz/0sQQKWm4j1pOdMt8Mpgwb5HLOXTI/v0cX0vaMGV
F28yCAcevSF+3fB52rLEYlTp62vsicMr813Os6abNXkyT3CC5o10NG+aI5Kq9cSl
8SwXb9tO6+yl+9QpgFq+9BYCuMQh2623iMPmNwiFRzt2GvOei6df2XVcw4ANYEKI
dio+FHb/wHUR4jsB0bTUoQI

Bug#836074: marked as done (wpa FTCBFS: uses build architecture pkg-config)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:32:55 +
with message-id 
and subject line Bug#836074: fixed in wpa 2.5-2+v2.4-3
has caused the Debian Bug report #836074,
regarding wpa FTCBFS: uses build architecture pkg-config
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
836074: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836074
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: wpa
Version: 2.5-2+v2.4-2
User: helm...@debian.org
Usertags: rebootstrap

wpa fails to cross build from source. The first cause is that it uses
the build architecture pkg-config. Using the triplet prefixed tool
alleviates that problem, which is what the attached patch does.

It then uses the build architecture compiler for building
wpa_supplicant/wpa_gui-qt4. I don't have sufficient knowledge on qmake
to fix this now, so I do not address this problem in my patch.
Furthermore, I think that it should be fixed in debhelper's qmake
buildsystem instead of wpa itself.

Can you apply the patch even though it doesn't fix the build? That'd
simplify figuring out how to make qmake work for cross building
(exporting QMAKE_CC doesn't do the trick).

Note that I slightly changed the method for setting CC, such that clang
based native builds also work.

Helmut
diff --minimal -Nru wpa-2.5-2+v2.4/debian/changelog 
wpa-2.5-2+v2.4/debian/changelog
--- wpa-2.5-2+v2.4/debian/changelog 2016-08-09 20:12:11.0 +0200
+++ wpa-2.5-2+v2.4/debian/changelog 2016-08-30 14:37:10.0 +0200
@@ -1,3 +1,10 @@
+wpa (2.5-2+v2.4-2.1) UNRELEASED; urgency=medium
+
+  * Non-maintainer upload.
+  * Address FTCBFS: Set PKG_CONFIG.
+
+ -- Helmut Grohne   Tue, 30 Aug 2016 14:19:27 +0200
+
 wpa (2.5-2+v2.4-2) unstable; urgency=medium
 
   * Apply patches from upstream to unbreak dedicated P2P Device support
diff --minimal -Nru 
wpa-2.5-2+v2.4/debian/patches/01_use_pkg-config_for_pcsc-lite_module.patch 
wpa-2.5-2+v2.4/debian/patches/01_use_pkg-config_for_pcsc-lite_module.patch
--- wpa-2.5-2+v2.4/debian/patches/01_use_pkg-config_for_pcsc-lite_module.patch  
2016-08-09 19:50:18.0 +0200
+++ wpa-2.5-2+v2.4/debian/patches/01_use_pkg-config_for_pcsc-lite_module.patch  
2016-08-30 14:23:15.0 +0200
@@ -10,7 +10,7 @@
  #LIBS += -lwinscard
  else
 -LIBS += -lpcsclite -lpthread
-+LIBS += $(shell pkg-config --libs libpcsclite)
++LIBS += $(shell $(PKG_CONFIG) --libs libpcsclite)
  endif
  endif
  
diff --minimal -Nru wpa-2.5-2+v2.4/debian/rules wpa-2.5-2+v2.4/debian/rules
--- wpa-2.5-2+v2.4/debian/rules 2016-07-28 20:42:47.0 +0200
+++ wpa-2.5-2+v2.4/debian/rules 2016-08-30 14:36:38.0 +0200
@@ -15,13 +15,13 @@
 BINDIR= /sbin
 V = 1
 
-DEB_BUILD_GNU_TYPE := $(shell dpkg-architecture -qDEB_BUILD_GNU_TYPE)
 DEB_HOST_GNU_TYPE  := $(shell dpkg-architecture -qDEB_HOST_GNU_TYPE)
-ifneq ($(DEB_HOST_GNU_TYPE),$(DEB_BUILD_GNU_TYPE))
+ifeq ($(origin CC),default)
CC=$(DEB_HOST_GNU_TYPE)-gcc
 endif
+PKG_CONFIG ?= $(DEB_HOST_GNU_TYPE)-pkg-config
 
-export CC BINDIR V
+export CC BINDIR V PKG_CONFIG
 
 DEB_HOST_ARCH_OS  ?= $(shell dpkg-architecture -qDEB_HOST_ARCH_OS)
 HOSTAPD_DOT_CONFIG:= debian/config/hostapd/$(DEB_HOST_ARCH_OS)
--- End Message ---
--- Begin Message ---
Source: wpa
Source-Version: 2.5-2+v2.4-3

We believe that the bug you reported is fixed in the latest version of
wpa, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 836...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Andrew Shadura  (supplier of updated wpa package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA1

Format: 1.8
Date: Wed, 14 Sep 2016 11:11:01 +0200
Source: wpa
Binary: hostapd wpagui wpasupplicant wpasupplicant-udeb
Architecture: source
Version: 2.5-2+v2.4-3
Distribution: unstable
Urgency: medium
Maintainer: Debian wpasupplicant Maintainers 

Changed-By: Andrew Shadura 
Description:
 hostapd- IEEE 802.11 AP and IEEE 802.1X/WPA/WPA2/EAP Authenticator
 wpagui - graphical user interface for wpa_supplicant
 wpasupplicant - client support for WPA and WPA2 (IEEE 802.11i)
 wpasupplicant-udeb - Client support for WPA and WPA2 (IEEE 802.11i) (u

Bug#837176: marked as done (usbguard: set/ship proper RuleFile=/)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:32:37 +
with message-id 
and subject line Bug#837176: fixed in usbguard 0.5.14+ds1-2
has caused the Debian Bug report #837176,
regarding usbguard: set/ship proper RuleFile=/
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837176: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837176
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: usbguard
Version: 0.5.14+ds1-1
Severity: normal


Hi.

Currently, the config has the following set:
RuleFile=/usr/local/etc/usbguard/rules.conf

Isn't this a config file that may also be set via the IPC of the daemon?
However, not even /usr/local/etc/usbguard would exist, nor should
that IMO placed in /usr but rather /etc.

Cheers,
Chris.



-- System Information:
Debian Release: stretch/sid
  APT prefers unstable-debug
  APT policy: (500, 'unstable-debug'), (500, 'unstable')
Architecture: amd64 (x86_64)

Kernel: Linux 4.7.0-1-amd64 (SMP w/8 CPU cores)
Locale: LANG=en_DE.UTF-8, LC_CTYPE=en_DE.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages usbguard depends on:
ii  init-system-helpers  1.42
ii  libc62.24-2
ii  libcap-ng0   0.7.7-3
ii  libdbus-1-3  1.10.10-1
ii  libdbus-glib-1-2 0.106-1
ii  libgcc1  1:6.2.0-3
ii  libglib2.0-0 2.49.6-1
ii  libqb0   1.0-1
ii  libseccomp2  2.3.1-2
ii  libstdc++6   6.2.0-3
ii  libusbguard0 0.5.14+ds1-1

usbguard recommends no packages.

usbguard suggests no packages.

-- no debconf information
--- End Message ---
--- Begin Message ---
Source: usbguard
Source-Version: 0.5.14+ds1-2

We believe that the bug you reported is fixed in the latest version of
usbguard, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Muri Nicanor  (supplier of updated usbguard package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Tue, 13 Sep 2016 18:39:53 +0200
Source: usbguard
Binary: libusbguard-dev libusbguard0 usbguard usbguard-applet-qt
Architecture: source
Version: 0.5.14+ds1-2
Distribution: unstable
Urgency: medium
Maintainer: Muri Nicanor 
Changed-By: Muri Nicanor 
Description:
 libusbguard-dev - USB device authorization policy framework - development files
 libusbguard0 - USB device authorization policy framework - shared library
 usbguard   - USB device authorization policy framework
 usbguard-applet-qt - USB device authorization policy framework - qt applet
Closes: 836712 836713 837175 837176
Changes:
 usbguard (0.5.14+ds1-2) unstable; urgency=medium
 .
   * d/control:
- Add systemd to build dependencies (Closes: #836713)
- Change architectures to linux-any in d/control
   * d/rules
- Add sysconfdir flag to autoconf (Closes: #837176)
   * d/patches/
- Fix mips build (Closes: #836712)
- Set correct IPCAllowedGroups (Closes: #837175)
Checksums-Sha1:
 a444d7047698c6e9292dfe27b27986a2ca7d9b48 2270 usbguard_0.5.14+ds1-2.dsc
 54d6da684aa81867d26005acb1d075008eeb7f41 16152 
usbguard_0.5.14+ds1-2.debian.tar.xz
Checksums-Sha256:
 35482e0cc24f8633c0ed116bca31414e1a8e410731c53b6ece4678d611ee059a 2270 
usbguard_0.5.14+ds1-2.dsc
 666caf46c13f0600b11e5611c71498ddca18bbe4e66c038c5c4a359c52e90d72 16152 
usbguard_0.5.14+ds1-2.debian.tar.xz
Files:
 170100f4076b667a6c1e1e4f275df3f7 2270 utils optional usbguard_0.5.14+ds1-2.dsc
 0a1f2fc6501da246b7eee364e35c90cf 16152 utils optional 
usbguard_0.5.14+ds1-2.debian.tar.xz

-BEGIN PGP SIGNATURE-
Version: GnuPG v2

iQIcBAEBCAAGBQJX2RMdAAoJEPNPCXROn13ZmMUQAImb+To8jy4RQISfKtqDq4SZ
hwamw2sF5TrEz5pkkPa7ljSWCr/pHXpAqNBnJPvm9qc6l7+yNEH5s49dFHhm13qD
igl1/5hBlKKsdrBqAQ8nItkvGNwWq7Y9aj51q24f/w60u8ORMCfJ2g17gaUX5J4s
af9pbuXNpcyQmF7psv/yRtMz/0sQQKWm4j1pOdMt8Mpgwb5HLOXTI/v0cX0vaMGV
F28yCAcevSF+3fB52rLEYlTp62vsicMr813Os6abNXkyT3CC5o10NG+aI5Kq9cSl
8SwXb9tO6+yl+9QpgFq+9BYCuMQh2623iMPmNwiFRzt2GvOei6df2XVcw4ANYEKI
dio+FHb/wHUR4jsB0bTUoQILNX9Z9lUAZPaS0y/AXERWHVkzKqtrQ6p5oJ2GiXIm
UMtzFuQ9DWHMXEsG4hxBYmvDraLsFfjPywUX2qv4t9yZ4OQNfYy7pXMH5fYU2GSR
jn2JZ93FJHziS1lzQ

Bug#837727: marked as done (gnome-shell-extension-top-icon-plus: Not installable with gnome-shell >= 3.21.92)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:23:48 +
with message-id 
and subject line Bug#837727: fixed in gnome-shell-extension-top-icons-plus 15-3
has caused the Debian Bug report #837727,
regarding gnome-shell-extension-top-icon-plus: Not installable with gnome-shell 
>= 3.21.92
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837727: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837727
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: gnome-shell-extension-top-icon-plus
Version: 15-2
Severity: serious
User: pkg-gnome-maintain...@lists.alioth.debian.org
Usertags: gnome-shell-3-22

Hi,

your package gnome-shell-extension-top-icon-plus declares a strictly
versioned dependency on gnome-shell. We've uploaded gnome-shell
3.21.92 to unstable, which makes gnome-shell-extension-top-icon-plus
uninstallable.

In the past, it was necessary to explicitly declare supported
gnome-shell versions in metadata.json. This was lifted in gnome-shell
3.21.92 [1].

"Nowadays, the user interface has mostly stabilized with most changes
happening under the hood. As a result, extensions written for
previous versions of GNOME Shell are very much expected to keep
working on updates, if it wasn't for the version check that requires
a version bump in the extension metadata. There has been a setting to
disable that check for a while, but it's existence isn't widely known
(hence the common perception that "everything breaks on updates").
While there is still some risk that an out-of-date extension can be
enabled without error, but fails spectacularly later (where we cannot
catch the exception), it is reasonably small by now when compared to
the ~95% of extensions that can be "unbroken", so swap the default
value to disable version checks by default."

As a result, you could drop the gnome-shell << XXX version limitation
altogether. The Debian release cycle is pretty long though, so we
don't know yet if the gnome-shell version in Buster will actually be
compatible with your extension today. We will release Stretch with
GNOME Shell 3.22, so my recommendation would be to use gnome-shell
(<< 3.23) as upper limt.

Modifications for metadata.json are no longer required.

Regards, Michael

[1] https://git.gnome.org/browse/gnome-shell/commit/?id=5e0e3e
--- End Message ---
--- Begin Message ---
Source: gnome-shell-extension-top-icons-plus
Source-Version: 15-3

We believe that the bug you reported is fixed in the latest version of
gnome-shell-extension-top-icons-plus, which is due to be installed in the 
Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Simon McVittie  (supplier of updated 
gnome-shell-extension-top-icons-plus package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 09:01:14 +0100
Source: gnome-shell-extension-top-icons-plus
Binary: gnome-shell-extension-top-icons-plus
Architecture: source
Version: 15-3
Distribution: unstable
Urgency: medium
Maintainer: Simon McVittie 
Changed-By: Simon McVittie 
Description:
 gnome-shell-extension-top-icons-plus - GNOME Shell extension to move system 
tray icons to top bar
Closes: 837727
Changes:
 gnome-shell-extension-top-icons-plus (15-3) unstable; urgency=medium
 .
   * Rely on gnome-shell >= 3.21.92 having dropped version-checks
 by default (Closes: #837727)
 - Drop patch to metadata.json. It only declares compatibility with
   3.20, but that's OK because the version-check is disabled by
   default now.
 - Depends: gnome-shell (<< 3.23). This avoids using stretch versions
   of this extension with buster versions of GNOME Shell, since we
   can't predict whether it will be 100% compatible
Checksums-Sha1:
 44e0405c3d231f34a4f026b329120d34fb7c0a95 2120 
gnome-shell-extension-top-icons-plus_15-3.dsc
 0f1d0339e9de54b0c5bdf1e5a5b7c6ca0f6cff0b 3408 
gnome-shell-extension-top-icons-plus_15-3.debian.tar.xz
Checksums-Sha256:
 bc43da3418af66413b9aa50a43cea5a3712041f270e5592bc7c08199b11fc3b1 2120 
gnome-shell-extension-top-icons-plus_15-3.dsc
 8e3ce28bcae23da6dc396d316fd7506618d68f063d6575c846f67323a2c3bad2 3408 
gnome-shell-ext

Bug#837725: marked as done (gnome-shell-extension-caffeine: Not installable with gnome-shell >= 3.21.92)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:23:38 +
with message-id 
and subject line Bug#837725: fixed in gnome-shell-extension-caffeine 
0~git20160329-3
has caused the Debian Bug report #837725,
regarding gnome-shell-extension-caffeine: Not installable with gnome-shell >= 
3.21.92
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837725: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837725
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: gnome-shell-extension-caffeine
Version: 0~git20160329-2
Severity: serious
User: pkg-gnome-maintain...@lists.alioth.debian.org
Usertags: gnome-shell-3-22

Hi,

your package gnome-shell-extension-caffeine declares a strictly
versioned dependency on gnome-shell. We've uploaded gnome-shell
3.21.92 to unstable, which makes gnome-shell-extension-caffeine
uninstallable.

In the past, it was necessary to explicitly declare supported
gnome-shell versions in metadata.json. This was lifted in gnome-shell
3.21.92 [1].

"Nowadays, the user interface has mostly stabilized with most changes
happening under the hood. As a result, extensions written for
previous versions of GNOME Shell are very much expected to keep
working on updates, if it wasn't for the version check that requires
a version bump in the extension metadata. There has been a setting to
disable that check for a while, but it's existence isn't widely known
(hence the common perception that "everything breaks on updates").
While there is still some risk that an out-of-date extension can be
enabled without error, but fails spectacularly later (where we cannot
catch the exception), it is reasonably small by now when compared to
the ~95% of extensions that can be "unbroken", so swap the default
value to disable version checks by default."

As a result, you could drop the gnome-shell << XXX version limitation
altogether. The Debian release cycle is pretty long though, so we
don't know yet if the gnome-shell version in Buster will actually be
compatible with your extension today. We will release Stretch with
GNOME Shell 3.22, so my recommendation would be to use gnome-shell
(<< 3.23) as upper limt.

Modifications for metadata.json are no longer required.

Regards, Michael

[1] https://git.gnome.org/browse/gnome-shell/commit/?id=5e0e3e
--- End Message ---
--- Begin Message ---
Source: gnome-shell-extension-caffeine
Source-Version: 0~git20160329-3

We believe that the bug you reported is fixed in the latest version of
gnome-shell-extension-caffeine, which is due to be installed in the Debian FTP 
archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Simon McVittie  (supplier of updated 
gnome-shell-extension-caffeine package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 09:19:41 +0100
Source: gnome-shell-extension-caffeine
Binary: gnome-shell-extension-caffeine
Architecture: source
Version: 0~git20160329-3
Distribution: unstable
Urgency: medium
Maintainer: Simon McVittie 
Changed-By: Simon McVittie 
Description:
 gnome-shell-extension-caffeine - GNOME Shell extension to keep your computer 
awake
Closes: 837725
Changes:
 gnome-shell-extension-caffeine (0~git20160329-3) unstable; urgency=medium
 .
   * Rely on gnome-shell >= 3.21.92 having dropped version-checks
 by default (Closes: #837725)
 - Drop patch to metadata.json. It only declares compatibility with
   3.20, but that's OK because the version-check is disabled by
   default now.
 - Depends: gnome-shell (<< 3.23). This avoids using stretch versions
   of this extension with buster versions of GNOME Shell, since we
   can't predict whether it will be 100% compatible
Checksums-Sha1:
 40843c498dd12c3a92ea37a460287249645a2a15 2157 
gnome-shell-extension-caffeine_0~git20160329-3.dsc
 ff7a26d8b0ebb903b1ad90736a29d9cab03df587 3756 
gnome-shell-extension-caffeine_0~git20160329-3.debian.tar.xz
Checksums-Sha256:
 cc5e874dd00d280df94ceed11ba1410b7b8ec39647087cf6325941085d007045 2157 
gnome-shell-extension-caffeine_0~git20160329-3.dsc
 23386d48138ef4c258b05d1e49d2fb880597d113b9dcd25b37b84a6d11f117a3 3756 
gnome-shell-extension

Bug#837726: marked as done (gnome-shell-extension-mediaplayer: Not installable with gnome-shell >= 3.21.92)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:23:43 +
with message-id 
and subject line Bug#837726: fixed in gnome-shell-extension-mediaplayer 
0~git20160509-3
has caused the Debian Bug report #837726,
regarding gnome-shell-extension-mediaplayer: Not installable with gnome-shell 
>= 3.21.92
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837726: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837726
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: gnome-shell-extension-mediaplayer
Version: 0~git201600509-2
Severity: serious
User: pkg-gnome-maintain...@lists.alioth.debian.org
Usertags: gnome-shell-3-22

Hi,

your package gnome-shell-extension-mediaplayer declares a strictly
versioned dependency on gnome-shell. We've uploaded gnome-shell
3.21.92 to unstable, which makes gnome-shell-extension-mediaplayer
uninstallable.

In the past, it was necessary to explicitly declare supported
gnome-shell versions in metadata.json. This was lifted in gnome-shell
3.21.92 [1].

"Nowadays, the user interface has mostly stabilized with most changes
happening under the hood. As a result, extensions written for
previous versions of GNOME Shell are very much expected to keep
working on updates, if it wasn't for the version check that requires
a version bump in the extension metadata. There has been a setting to
disable that check for a while, but it's existence isn't widely known
(hence the common perception that "everything breaks on updates").
While there is still some risk that an out-of-date extension can be
enabled without error, but fails spectacularly later (where we cannot
catch the exception), it is reasonably small by now when compared to
the ~95% of extensions that can be "unbroken", so swap the default
value to disable version checks by default."

As a result, you could drop the gnome-shell << XXX version limitation
altogether. The Debian release cycle is pretty long though, so we
don't know yet if the gnome-shell version in Buster will actually be
compatible with your extension today. We will release Stretch with
GNOME Shell 3.22, so my recommendation would be to use gnome-shell
(<< 3.23) as upper limt.

Modifications for metadata.json are no longer required.

Regards, Michael

[1] https://git.gnome.org/browse/gnome-shell/commit/?id=5e0e3e
--- End Message ---
--- Begin Message ---
Source: gnome-shell-extension-mediaplayer
Source-Version: 0~git20160509-3

We believe that the bug you reported is fixed in the latest version of
gnome-shell-extension-mediaplayer, which is due to be installed in the Debian 
FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Simon McVittie  (supplier of updated 
gnome-shell-extension-mediaplayer package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Wed, 14 Sep 2016 09:18:45 +0100
Source: gnome-shell-extension-mediaplayer
Binary: gnome-shell-extension-mediaplayer
Architecture: source
Version: 0~git20160509-3
Distribution: unstable
Urgency: medium
Maintainer: Simon McVittie 
Changed-By: Simon McVittie 
Description:
 gnome-shell-extension-mediaplayer - GNOME Shell extension to control media 
players
Closes: 837726
Changes:
 gnome-shell-extension-mediaplayer (0~git20160509-3) unstable; urgency=medium
 .
   * Rely on gnome-shell >= 3.21.92 having dropped version-checks
 by default (Closes: #837726)
 - Drop patch to metadata.json. It only declares compatibility with
   3.20, but that's OK because the version-check is disabled by
   default now.
 - Depends: gnome-shell (<< 3.23). This avoids using stretch versions
   of this extension with buster versions of GNOME Shell, since we
   can't predict whether it will be 100% compatible
Checksums-Sha1:
 f0d6f86aeaee045fe80a91cbac3396288a466200 2254 
gnome-shell-extension-mediaplayer_0~git20160509-3.dsc
 bf5558c6aa848656c6b1bc57ca25fe3ad9ed87ec 3192 
gnome-shell-extension-mediaplayer_0~git20160509-3.debian.tar.xz
Checksums-Sha256:
 1ab57947e42d102d86b05a823786012fc94a295f45952a8a71c47199309983b5 2254 
gnome-shell-extension-mediaplayer_0~git20160509-3.dsc
 ea2a1dd5ef19d4f6cc5d037207243a7c6398db412fd59cc4d

Bug#837717: marked as done (debian-maintainers: Annual ping for Guilhem Moulin)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 11:23:44 +0100
with message-id 
and subject line Re: Bug#837717: debian-maintainers: Annual ping for Guilhem 
Moulin
has caused the Debian Bug report #837717,
regarding debian-maintainers: Annual ping for Guilhem Moulin
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837717: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837717
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: debian-maintainers
Severity: normal

Hi there,

This is my annual ping.  I'm still active in Debian, so please keep my
key in the DM keyring.

Cheers,
-- 
Guilhem.


signature.asc
Description: PGP signature
--- End Message ---
--- Begin Message ---
X-CrossAssassin-Score: 66305--- End Message ---


Bug#837363: marked as done (cpputest: Please build libCppUTest.a with -fPIC)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:19:53 +
with message-id 
and subject line Bug#837363: fixed in cpputest 3.8-4
has caused the Debian Bug report #837363,
regarding cpputest: Please build libCppUTest.a with -fPIC
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837363: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837363
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: cpputest
Version: 3.8-3
Severity: important
User: bal...@balintreczey.hu
Usertags: pie-bindnow-20160906
Justification: makes other packages FTBFS with extra hardening
Tags: patch
Affects: bzflag


Dear Maintainers,

During a rebuild of all packages in sid, other packages
failed to build on amd64 with patched GCC and dpkg. The root cause
seems to be that libCppUTest.a is shipped as a non-PIC library.

The rebuild tested if packages are ready for a transition
enabling PIE and bindnow for amd64.

For more information about the changes to sid's dpkg and GCC please
visit:
https://wiki.debian.org/Hardening/PIEByDefaultTransition

Relevant part of bzflag's build log:
...
/bin/bash ../libtool --silent  --tag=CXX  --silent --mode=link g++ -lCppUTest 
-g -O2 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat 
-Werror=format-security  -Wl,-z,relro -Wl,-z,now -Wl,--as-needed  -o unittests 
unittests-tests.o unittests-bans.o unittests-AccessControlList.o 
../src/common/libCommon.la -lc -lm  -lpthread
/usr/bin/ld: 
/usr/lib/gcc/x86_64-linux-gnu/6/../../../x86_64-linux-gnu/libCppUTest.a(lib_libCppUTest_a-CommandLineTestRunner.o):
 relocation R_X86_64_32S against symbol `_ZTV21CommandLineTestRunner' can not 
be used when making a shared object; recompile with -fPIC
...

The full build log is available from:
https://people.debian.org/~rbalint/build-logs/pie-bindnow-20160906/bzflag_2.4.6-1_amd64.build.gz

Thanks,
Balint
--- End Message ---
--- Begin Message ---
Source: cpputest
Source-Version: 3.8-4

We believe that the bug you reported is fixed in the latest version of
cpputest, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Raphaël Hertzog  (supplier of updated cpputest package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Wed, 14 Sep 2016 11:13:00 +0200
Source: cpputest
Binary: cpputest libcpputest-dev
Architecture: source
Version: 3.8-4
Distribution: unstable
Urgency: medium
Maintainer: Raphaël Hertzog 
Changed-By: Raphaël Hertzog 
Description:
 cpputest   - C/C++ based unit test framework — main package
 libcpputest-dev - C/C++ based unit test framework — headers and static 
libraries
Closes: 837363
Changes:
 cpputest (3.8-4) unstable; urgency=medium
 .
   * Build static libraries with -fPIC so that executables linked against
 CppUTest can be built with -fPIE. Closes: #837363
Checksums-Sha1:
 e774c191086eceb1274d2c44f63c25915611c09b 1639 cpputest_3.8-4.dsc
 0a3ddf3340e53cf56c1237a18b685f23fd08f123 5340 cpputest_3.8-4.debian.tar.xz
Checksums-Sha256:
 92291243a07c107a4acc8f3283fd91b45add15df13540245fe62ff800655a605 1639 
cpputest_3.8-4.dsc
 17ba9df70375edd62579c1b7ae626ec6c770ca976e8c061f8a34ba85649feb7b 5340 
cpputest_3.8-4.debian.tar.xz
Files:
 7b83f4fa4a996eaaf53c3983c7e5a19d 1639 devel optional cpputest_3.8-4.dsc
 7d133bfdb060ffb9f9ee93a9ee543e45 5340 devel optional 
cpputest_3.8-4.debian.tar.xz

-BEGIN PGP SIGNATURE-
Comment: Signed by Raphael Hertzog

iQEcBAEBCgAGBQJX2RTBAAoJEAOIHavrwpq5Ta8H/ijufE+XpkodfsrMYQTH3FV/
581YhzYiUdRhVchYPT9YbH2kLEFCY5BwACPF9e0JQca062eEiZbKjf+sK6js4b0i
3EMUQrwnuRhBEMcTK8TYSGRljbFkcgdUwCrAbB93vCoqn8xiiQWTcPFh80UiG/Kh
w4AQKjfFPly3YNRRZwaSOcnZIBveIGBLyC79tD7HIV7HIcY9AE5r1VjyPRWfGlgV
XluknX355E5XXrtgHbzpYYwshikXZUEUOwFa1dtOQNbHSg5D1ZTpVykkw4FeZroN
biIYxQ8gCrbCMxKTdjsSIh4dpa5HTTtil22HBwLby4i36wu0FgtZ8ZR//1uhY4Y=
=z0kN
-END PGP SIGNATURE End Message ---


Bug#636324: marked as done (RFP: digbuild -- a voxel-based game similar to Minecraft)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:20:17 +
with message-id 
and subject line closing RFP: digbuild -- a voxel-based game similar to 
Minecraft
has caused the Debian Bug report #636324,
regarding RFP: digbuild -- a voxel-based game similar to Minecraft
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
636324: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=636324
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Severity: wishlist

* Package name: digbuild
  Version : 0
  Upstream Author : Evan Mezeske 
* URL : https://github.com/emezeske/digbuild
* License : GPL-2+
  Programming Lang: (C, C++, C#, Perl, Python, etc.)
  Description : a voxel-based game similar to Minecraft

Digbuild is an experimental voxel-based game project. It supports
various light effects (colored lighting, translucent materials,
bump-/specular mapping).

(the game is not yet release ready yet, so this rfp might be premature.
i nevertheless filed it to organize its unpackaged build dependencies
libthreadpool, libagar and libgmtl in a bts friendly way.)


--- End Message ---
--- Begin Message ---
RFP 636324 has no visible progress for a long time, so closing.--- End Message ---


Bug#636320: marked as done (RFP: libgmtl -- the Generic Math Template Library (GMTL))

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:20:17 +
with message-id 
and subject line closing RFP: libgmtl -- the Generic Math Template Library 
(GMTL)
has caused the Debian Bug report #636320,
regarding RFP: libgmtl -- the Generic Math Template Library (GMTL)
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
636320: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=636320
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Severity: wishlist

* Package name: libgmtl
  Version : 0.6.1
  Upstream Author : Allen Bierbaum ,
Kevin Meinert ,
Ben Scott 
* URL : http://ggt.sourceforge.net
* License : LGPL-2
  Programming Lang: C++
  Description : the Generic Math Template Library (GMTL)

GMTL is a high-performance, extensible and generic math library. Like
STL, it only consists of header files.


--- End Message ---
--- Begin Message ---
RFP 636320 has no visible progress for a long time, so closing.--- End Message ---


Bug#636313: marked as done (RFP: libthreadpool -- a cross-platform C++ thread pool library)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:20:17 +
with message-id 
and subject line closing RFP: libthreadpool -- a cross-platform C++ thread pool 
library
has caused the Debian Bug report #636313,
regarding RFP: libthreadpool -- a cross-platform C++ thread pool library
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
636313: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=636313
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Severity: wishlist

* Package name: libthreadpool
  Version : 0.2.5
  Upstream Author : Philipp Henkel 
* URL : http://threadpool.sourceforge.net/
* License : boost
  Programming Lang: C++
  Description : a cross-platform C++ thread pool library

threadpool is a cross-platform C++ thread pool library that provides
policy based scheduling and shutdown behavior. It integrates with STL
and boost.

(packaging could be interesting as this will only have a -dev package,
as it consists only of header files.)


--- End Message ---
--- Begin Message ---
RFP 636313 has no visible progress for a long time, so closing.--- End Message ---


Bug#635987: marked as done (RFP: libflickr-api2-perl -- Perl bindings to Flickr API)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:20:17 +
with message-id 
and subject line closing RFP: libflickr-api2-perl -- Perl bindings to Flickr API
has caused the Debian Bug report #635987,
regarding RFP: libflickr-api2-perl -- Perl bindings to Flickr API
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
635987: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=635987
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: libflickr-api-perl
Version: 1.01-3
Severity: wishlist

There is a updated fork, https://github.com/TJC/Flickr-API2
Maybe use that as source instead, or offer it alongside this package.


--- End Message ---
--- Begin Message ---
RFP 635987 has no visible progress for a long time, so closing.--- End Message ---


Bug#837749: marked as done (RFS: forge/0.9.0-1 [ITP])

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:07:58 + (UTC)
with message-id <1900664498.1506785.1473847678...@mail.yahoo.com>
and subject line Re: Bug#837749: RFS: forge/0.9.0-1 [ITP]
has caused the Debian Bug report #837749,
regarding RFS: forge/0.9.0-1 [ITP]
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837749: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837749
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---

Package: sponsorship-requests
Severity: wishlist

Dear mentors,

I am looking for a sponsor for my package "forge":

* Package name: forge
  Version : 0.9.0-1
  Upstream Author : ArrayFire
* URL : https://github.com/arrayfire/forge
* License : BSD
  Section : libs

It builds those binary packages:

  forge-doc - documentation for forge
  libforge-dev - development files for forge
  libforge0 - high-performance OpenGL visualization

The packaging repository can be checked out at:

  https://anonscm.debian.org/git/debian-science/packages/forge.git

Successful build(s) on debomatic:


http://debomatic-i386.debian.net/distribution#unstable/forge/0.9.0-1/buildlog

Changes since the last upload:

  * Initial release. (Closes: #834723)

Regards,
Ghislain Vaillant
--- End Message ---
--- Begin Message ---
Hi,
>
>I am looking for a sponsor for my package "forge":

missing copyright in 
CMakeModules/FindOpenCL.cmake
(this comes from cmake modules in /usr/share/cmake-*/Modules)
with a little different copyright header


but the licenses were good enough, sponsored.

G.--- End Message ---


Bug#837609: marked as done (RFS: budgie-desktop/10.2.7-1)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:48:31 + (UTC)
with message-id <1942153070.1470241.1473846511...@mail.yahoo.com>
and subject line Re: Bug#837609: RFS: budgie-desktop/10.2.7-1
has caused the Debian Bug report #837609,
regarding RFS: budgie-desktop/10.2.7-1
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837609: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837609
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: sponsorship-requests
  Severity: normal

  Dear mentors,

  I am looking for a sponsor for my package "budgie-desktop"

 * Package name: budgie-desktop
   Version : 10.2.7-1
   Upstream Author : i...@solus-project.com
 * URL : https://github.com/solus-project/budgie-desktop
 * License : LGPL-2.1/GPL2.0
   Section : x11

  It builds those binary packages:

 budgie-core - Core package for Budgie-Desktop
 budgie-core-dev - Development package for budgie-desktop
 budgie-desktop - Desktop package for budgie-desktop
 budgie-desktop-doc - documentation files for the budgie-desktop
 gir1.2-budgie-desktop-1.0 - GNOME introspection library for budgie-desktop
 libbudgie-plugin0 - Plugin library for budgie-desktop
 libbudgietheme0 - Theme library for budgie-desktop
 libraven0  - Raven library for budgie-desktop

  To access further information about this package, please visit the
following URL:

  https://mentors.debian.net/package/budgie-desktop


  Alternatively, one can download the package with dget using this command:

dget -x 
https://mentors.debian.net/debian/pool/main/b/budgie-desktop/budgie-desktop_10.2.7-1.dsc

  Notes:

  upstream released 10.2.7.  Series of patches have subsequently been
added to git by the maintainer,

 summary of patches follows:


  patch 1: 0001 is requested by the upstream maintainer since causes
serious display issues with

  the budgie icon-tasklist is not displayed correctly.

  patch 2: Debian and Ubuntu only patch. Workaround patch for Debian based

  systems to stop crashes for budgie-panel and whole session crashes

  patch 3: volume patch

  upstream usability patch since volume indicator is not discoverable


  Debian packaging:

  have retested package but with a standard simpler debhelper package

  but unfortunately the same issues as previous budgie-desktop version, that is

  the package appears to build correctly but does not launch correctly on logon.

  Therefore have kept the identical packaging as the previous upload in stretch.


  Tested the source and .debs with lintian -i -I and identical results

  as for the previous package 10.2.6-2

  Changes since the last upload:

  * New upstream release
- upstream release 10.2.7
  * Add upstream recommended patch
- 0001 - fix icontask lisk spacing after reboot
  * add patch to stop budgie-panel menu crash on apt refresh
  * add volume patch
- 0002 - fix volume usability for panel indicator
  * Packaging changes
- drop patches gtk-link and GNOME 3.22 build since
  these are included in the 10.2.7 release


  Regards,
   David Mohammed
--- End Message ---
--- Begin Message ---
Hi
sponsored, please fix the remaining stuff in a future release!

thanks

G.--- End Message ---


Bug#837469: marked as done (nmu: dose3_5.0.1-1)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 11:20:00 +0200
with message-id 
and subject line Re: Bug#837469: nmu: dose3_5.0.1-1
has caused the Debian Bug report #837469,
regarding nmu: dose3_5.0.1-1
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837469: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837469
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: release.debian.org
Severity: normal
User: release.debian@packages.debian.org
Usertags: binnmu

nmu dose3_5.0.1-1 . ANY . unstable . -m "rebuild for camlzip 1.06-1"
--- End Message ---
--- Begin Message ---
On 14/09/16 06:23, Johannes Schauer wrote:
> Hi,
> 
> Quoting Emilio Pozuelo Monfort (2016-09-14 00:47:01)
>> On 11/09/16 22:04, Johannes Schauer wrote:
>>> Package: release.debian.org
>>> Severity: normal
>>> User: release.debian@packages.debian.org
>>> Usertags: binnmu
>>>
>>> nmu dose3_5.0.1-1 . ANY . unstable . -m "rebuild for camlzip 1.06-1"
>>
>> Can you explain why this is needed? We don't like to blindly binNMU stuff, so
>> a little explanation is always helpful.
> 
> When src:dose3 (= 5.0.1-1) was originally built, it was built with src:camlzip
> (= 1.05-3) in the archive. This means that src:dose3 built libdose3-ocaml with
> a dependency on the virtual package libzip-ocaml-8wtm6 on amd64 which was
> provided by libzip-ocaml (= 1.05-3). Building the new src:camlzip release
> 1.06-1, replaced that libzip-ocaml package by a new version which now provides
> libzip-ocaml-4m8e9 on amd64. As a result, no package provides
> libzip-ocaml-8wtm6 anymore and libdose3-ocaml ocaml become uninstallable. You
> can verify this situation here:
> 
> https://packages.debian.org/sid/libdose3-ocaml (it says Package not available
> next to libzip-ocaml-8wtm6)
> 
> and here:
> 
> https://qa.debian.org/dose/debcheck/unstable_main/1473742805/packages/libdose3-ocaml.html
> 
> The situation is analogous on all other architectures than amd64.
> 
> The situation arises because OCaml packages are statically linked and
> rebuilding a library requires a rebuild of all its reverse dependencies. I was
> told in #debian-ocaml that usually Stéphane Glondu would schedule OCaml 
> binNMUs
> but he hasn't been on IRC for 3 days, so Mehdi Dogguy advised me to ask the
> release team to schedule the required binNMU of src:dose3.
> 
> One practical consequence of libdose3-ocaml not being installable right now 
> is,
> that src:botch is currently bd-uninstallable:
> 
> https://buildd.debian.org/status/package.php?p=botch

Just a simple "camlzip is an ocaml package, which changes the ABI on every
release, thus needs a rebuild to pick up the updated dependency" would have been
enough ;)

I didn't realise this was ocaml related from the name.

Scheduled now.

And looks like somebody already scheduled it before me without closing this, so
it will be double fixed :P

Cheers,
Emilio--- End Message ---


Bug#732872: marked as done (Add MariaDB as an alternative dependency)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 11:06:20 +0200
with message-id <6c936e97-897d-a737-7fdc-0ef0755af...@debian.org>
and subject line smbind was removed from Debian in 2013
has caused the Debian Bug report #732872,
regarding Add MariaDB as an alternative dependency
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
732872: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=732872
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: smbind
Severity: wishlist

MariaDB is an drop in replacement for MySQL. As MariaDB has just
landed in Debian unstable it would be a good time to include it in the
dependencies as an alternative to MySQL.

Please change in the debian/control any occurences of mysql-server and
mysql-client to "mariadb-server | mysql-server" and "mariadb-client |
mysql-client".

This way systems that have MariaDB installed instead of MySQL can use
this package without problems. While MariaDB is at the moment only in
Debian unstable, some users might have installed it from mariadb.org
or other sources to jessie or wheezy, so it does not hurt if this
package has these dependencies updated for older Debian releases too.

This is a very quick and safe change to do, and there is no urgency to
upload the package just for this small thing. Just update the
dependency (or suggest or recommends) lines in the debian/control file
and let the change propagate when there is something else to push too.

MariaDB packages in Debian:
http://packages.debian.org/search?keywords=mariadb&searchon=names&suite=all§ion=all


Thanks!

 - Otto
--- End Message ---
--- Begin Message ---
Version: 0.4.7-5.2+rm

smbind was last released with Debian 6.0 (squeeze) in
February 2011 and removed from Debian sid/unstable in 2013 (see
http://bugs.debian.org/731679 for details on the removal). Since
support for squeeze and squeeze-LTS has now ended, I'm closing all the
remaining bugs reported against this package.

Andreas--- End Message ---


Bug#732884: marked as done (Add MariaDB as an alternative dependency)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 11:03:13 +0200
with message-id 
and subject line drupal6 was superseded by drupal7 long ago
has caused the Debian Bug report #732884,
regarding Add MariaDB as an alternative dependency
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
732884: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=732884
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: drupal6
Severity: wishlist

MariaDB is an drop in replacement for MySQL. As MariaDB has just
landed in Debian unstable it would be a good time to include it in the
dependencies as an alternative to MySQL.

Please change in the debian/control any occurences of mysql-server and
mysql-client to "mariadb-server | mysql-server" and "mariadb-client |
mysql-client".

This way systems that have MariaDB installed instead of MySQL can use
this package without problems. While MariaDB is at the moment only in
Debian unstable, some users might have installed it from mariadb.org
or other sources to jessie or wheezy, so it does not hurt if this
package has these dependencies updated for older Debian releases too.

This is a very quick and safe change to do, and there is no urgency to
upload the package just for this small thing. Just update the
dependency (or suggest or recommends) lines in the debian/control file
and let the change propagate when there is something else to push too.

MariaDB packages in Debian:
http://packages.debian.org/search?keywords=mariadb&searchon=names&suite=all§ion=all


Thanks!

 - Otto
--- End Message ---
--- Begin Message ---
Version: 6.26-1.1+rm

drupal6 was last released with Debian 6.0 (squeeze) in
February 2011 and removed from Debian sid/unstable in 2013 (see
http://bugs.debian.org/708746 for details on the removal). Since
support for squeeze and squeeze-LTS has now ended, I'm closing all the
remaining bugs reported against this package.

Andreas--- End Message ---


Bug#732897: marked as done (Add MariaDB as an alternative dependency)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 11:00:00 +0200
with message-id 
and subject line nanourl was removed from debian in 2012
has caused the Debian Bug report #732897,
regarding Add MariaDB as an alternative dependency
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
732897: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=732897
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: nanourl
Severity: wishlist

MariaDB is an drop in replacement for MySQL. As MariaDB has just
landed in Debian unstable it would be a good time to include it in the
dependencies as an alternative to MySQL.

Please change in the debian/control any occurences of mysql-server and
mysql-client to "mariadb-server | mysql-server" and "mariadb-client |
mysql-client".

This way systems that have MariaDB installed instead of MySQL can use
this package without problems. While MariaDB is at the moment only in
Debian unstable, some users might have installed it from mariadb.org
or other sources to jessie or wheezy, so it does not hurt if this
package has these dependencies updated for older Debian releases too.

This is a very quick and safe change to do, and there is no urgency to
upload the package just for this small thing. Just update the
dependency (or suggest or recommends) lines in the debian/control file
and let the change propagate when there is something else to push too.

MariaDB packages in Debian:
http://packages.debian.org/search?keywords=mariadb&searchon=names&suite=all§ion=all


Thanks!

 - Otto
--- End Message ---
--- Begin Message ---
Version:

nanourl was last released with Debian 6.0 (squeeze) in
February 2011 and removed from Debian sid/unstable in 2012 (see
http://bugs.debian.org/689263 for details on the removal). Since
support for squeeze and squeeze-LTS has now ended, I'm closing all the
remaining bugs reported against this package.

Andreas--- End Message ---


Bug#836381: marked as done (RFS: couchapp/1.0.2+dfsg1-1)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:01:29 + (UTC)
with message-id <248477810.1407785.1473843689...@mail.yahoo.com>
and subject line Re: Bug#836381: RFS: couchapp/1.0.2+dfsg1-1
has caused the Debian Bug report #836381,
regarding RFS: couchapp/1.0.2+dfsg1-1
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
836381: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836381
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: sponsorship-requests
Severity: normal

Hello

I'm looking for an sponsor for my updated package couchapp

This package contains a new upstream release and other packaging changes

couchapp (1.0.2+dfsg1-1) unstable; urgency=medium

  * New upstream release.
  * Removed non-free bytes.
  * Add python-watchdog to build-dependencies
  * Bump standards to version 3.9.8. No changes needed.
  * Move to web section. (Closes: #832199).
  * Move packaging to git, add Vcs-* entries to control file.
  * Update copyright file.
  * Create gbp.conf.
  * Use pristine-tar for packaging.
  * Acknowledged NMU. (Closes: 785992).


The git repo is at
https://anonscm.debian.org/cgit/collab-maint/couchapp.git

Alternativelly, the package can be downloaded from mentors
https://mentors.debian.net/debian/pool/main/c/couchapp/couchapp_1.0.2+dfsg1-1.dsc

I'm a DM, I'd happily accept DM permissions to upload it to the archive

thanks!


-- System Information:
Debian Release: stretch/sid
  APT prefers testing
  APT policy: (900, 'testing'), (300, 'unstable')
Architecture: amd64 (x86_64)

Kernel: Linux 4.6.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=en_US.UTF-8, LC_CTYPE=en_US.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)
--- End Message ---
--- Begin Message ---
Hi,

>both can be used on the browser or git clone, neither of them can be

>used to push :(


I have the same issue (and I end up in manually changing the .git/config)
probably we are missing some global git configuration change, would you mind 
asking
on -mentors for advice?)

>its the upstream changelog, i generated it from git log


bonus points if you can autogenerate it, or convince upstream in providing one
in the src tarball
>ar, fixed. thanks


I tweaked the VCS-Git and uploaded on deferred/1

thanks for your contribution to Debian!

(and let me know if you don't like the fix, I also pushed the tag)

G.--- End Message ---


Bug#732904: marked as done (Add MariaDB as an alternative dependency)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:57:54 +0200
with message-id <783fdcac-020a-bd36-ef18-ced1487e3...@debian.org>
and subject line piwigo was removed from Debian in 2012
has caused the Debian Bug report #732904,
regarding Add MariaDB as an alternative dependency
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
732904: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=732904
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: piwigo
Severity: wishlist

MariaDB is an drop in replacement for MySQL. As MariaDB has just
landed in Debian unstable it would be a good time to include it in the
dependencies as an alternative to MySQL.

Please change in the debian/control any occurences of mysql-server and
mysql-client to "mariadb-server | mysql-server" and "mariadb-client |
mysql-client".

This way systems that have MariaDB installed instead of MySQL can use
this package without problems. While MariaDB is at the moment only in
Debian unstable, some users might have installed it from mariadb.org
or other sources to jessie or wheezy, so it does not hurt if this
package has these dependencies updated for older Debian releases too.

This is a very quick and safe change to do, and there is no urgency to
upload the package just for this small thing. Just update the
dependency (or suggest or recommends) lines in the debian/control file
and let the change propagate when there is something else to push too.

MariaDB packages in Debian:
http://packages.debian.org/search?keywords=mariadb&searchon=names&suite=all§ion=all


Thanks!

 - Otto
--- End Message ---
--- Begin Message ---
Version: 2.3.1-1

piwigo was last released with Debian 6.0 (squeeze) in
February 2011 and removed from Debian sid/unstable in 2012 (see
http://bugs.debian.org/694820 for details on the removal). Since
support for squeeze and squeeze-LTS has now ended, I'm closing all the
remaining bugs reported against this package.

Andreas--- End Message ---


Bug#732906: marked as done (Add MariaDB as an alternative dependency)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:54:55 +0200
with message-id 
and subject line poker-network has been removed from Debian in 2013
has caused the Debian Bug report #732906,
regarding Add MariaDB as an alternative dependency
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
732906: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=732906
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: python-poker2d
Severity: wishlist

MariaDB is an drop in replacement for MySQL. As MariaDB has just
landed in Debian unstable it would be a good time to include it in the
dependencies as an alternative to MySQL.

Please change in the debian/control any occurences of mysql-server and
mysql-client to "mariadb-server | mysql-server" and "mariadb-client |
mysql-client".

This way systems that have MariaDB installed instead of MySQL can use
this package without problems. While MariaDB is at the moment only in
Debian unstable, some users might have installed it from mariadb.org
or other sources to jessie or wheezy, so it does not hurt if this
package has these dependencies updated for older Debian releases too.

This is a very quick and safe change to do, and there is no urgency to
upload the package just for this small thing. Just update the
dependency (or suggest or recommends) lines in the debian/control file
and let the change propagate when there is something else to push too.

MariaDB packages in Debian:
http://packages.debian.org/search?keywords=mariadb&searchon=names&suite=all§ion=all


Thanks!

 - Otto
--- End Message ---
--- Begin Message ---
Version: 1.7.7-3.2+rm

poker-network was last released with Debian 6.0 (squeeze) in
February 2011 and removed from Debian sid/unstable in 2013 (see
http://bugs.debian.org/708871 for details on the removal). Since
support for squeeze and squeeze-LTS has now ended, I'm closing all the
remaining bugs reported against this package.

Andreas--- End Message ---


Bug#833623: marked as done (tracker.d.o: add multiarch hints)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 10:27:56 +0200
with message-id <20160914082756.6fndo53bdnyj7...@home.ouaza.com>
and subject line Re: Bug#833623: tracker.d.o: add multiarch hints
has caused the Debian Bug report #833623,
regarding tracker.d.o: add multiarch hints
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
833623: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=833623
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: tracker.debian.org
Severity: wishlist
X-Debbugs-CC: Helmut Grohne , Johannes Schauer 

Tags: patch

I've attached a patch to implement adding multiarch hints to
tracker.d.o. These multiarch hints are aimed at improving Debian's
multiarch support by adding multiarch metadata and fixing file
conflicts. The service providing them is run by Helmut Grohne.

-- 
bye,
pabs

https://wiki.debian.org/PaulWise
From 8aa11b6448ed78ac52a008f827ef6f362d1f217c Mon Sep 17 00:00:00 2001
From: Paul Wise 
Date: Sun, 7 Aug 2016 14:46:36 +0800
Subject: [PATCH] Add multiarch hints

---
 .../debian/templates/debian/multiarch-hints.html   |  8 +++
 distro_tracker/vendor/debian/tracker_tasks.py  | 73 ++
 2 files changed, 81 insertions(+)
 create mode 100644 distro_tracker/vendor/debian/templates/debian/multiarch-hints.html

diff --git a/distro_tracker/vendor/debian/templates/debian/multiarch-hints.html b/distro_tracker/vendor/debian/templates/debian/multiarch-hints.html
new file mode 100644
index 000..6679540
--- /dev/null
+++ b/distro_tracker/vendor/debian/templates/debian/multiarch-hints.html
@@ -0,0 +1,8 @@
+
+There are issues with the https://wiki.debian.org/MultiArch";>multiarch data for this package.
+
+{% for desc, link in item.extra_data %}
+{{ desc }}
+{% endfor %}
+
+
diff --git a/distro_tracker/vendor/debian/tracker_tasks.py b/distro_tracker/vendor/debian/tracker_tasks.py
index c7f053e..e76a517 100644
--- a/distro_tracker/vendor/debian/tracker_tasks.py
+++ b/distro_tracker/vendor/debian/tracker_tasks.py
@@ -2371,3 +2371,76 @@ class UpdateBuildReproducibilityTask(BaseTask):
 ActionItem.objects.delete_obsolete_items([self.action_item_type],
  packages)
 PackageExtractedInfo.objects.bulk_create(extracted_info)
+
+
+class MultiArchHintsTask(BaseTask):
+ACTIONS_WEB = 'https://wiki.debian.org/MultiArch/Hints'
+ACTIONS_URL = 'https://dedup.debian.net/static/multiarch-hints.yaml'
+ACTION_ITEM_TYPE_NAME = 'debian-multiarch-hints'
+ACTION_ITEM_TEMPLATE = 'debian/multiarch-hints.html'
+ACTION_ITEM_DESCRIPTION = 'Multiarch hinter reports {count} issue(s)'
+
+def __init__(self, force_update=False, *args, **kwargs):
+super(MultiArchHintsTask, self).__init__(*args, **kwargs)
+self.force_update = force_update
+self.action_item_type = ActionItemType.objects.create_or_update(
+type_name=self.ACTION_ITEM_TYPE_NAME,
+full_description_template=self.ACTION_ITEM_TEMPLATE)
+self.SEVERITIES = {}
+for value, name in ActionItem.SEVERITIES:
+self.SEVERITIES[name] = value
+
+def set_parameters(self, parameters):
+if 'force_update' in parameters:
+self.force_update = parameters['force_update']
+
+def get_data(self):
+return get_resource_content(self.ACTIONS_URL)
+
+def get_packages(self):
+data = self.get_data()
+data = yaml.safe_load(data)
+format = data['multiarch-hints-1.0']
+data = data['hints']
+packages = {}
+for item in data:
+if 'source' not in item:
+continue
+package = item['source']
+if package not in packages:
+packages[package] = {}
+wishlist = ActionItem.SEVERITY_WISHLIST
+severity = self.SEVERITIES.get(item['severity'], wishlist)
+packages[package]['severity'] = max(severity, hints[package].get('severity', wishlist))
+if 'hints' not in packages[package]:
+packages[package]['hints'] = []
+packages[package]['hints'].append((item['description'], item['link']))
+return packages
+
+def update_action_item(self, package, severity, description, extra_data):
+action_item = package.get_action_item_for_type(self.action_item_type.type_name)
+if action_item is None:
+action_item = ActionItem(
+package=package,
+item_type=self.action_item_type)
+action_item.severity = severity
+action_it

Bug#655356: marked as done (RFP: ltsp-cluster-lbagent -- LTSP loadbalancer agent offers variables about the state of the ltsp server)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 04:14:39 -0400
with message-id <1d4cc111-a1f3-053f-caed-4f98bf1cc...@linux.com>
and subject line [closing] RFP: ltsp-cluster-lbagent -- LTSP loadbalancer agent 
offers variables about the state of the ltsp server
has caused the Debian Bug report #655356,
regarding RFP: ltsp-cluster-lbagent -- LTSP loadbalancer agent offers variables 
about the state of the ltsp server
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
655356: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=655356
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Owner: Jonathan Carter 
Severity: wishlist

*** Please type your report below this line ***

* Package name: ltsp-cluster-agent
  Version : 0.8
  Upstream Author : Stéphane Graber, Vincent Vinet
* URL : https://launchpad.net/ltsp-cluster
* License : GNU GPL v2
  Programming Lang: Python
  Description : Generic python daemon for LTSP (core package)


--- End Message ---
--- Begin Message ---
Closing this RFP, as the upstream project is no longer alive and these
packages would serve little purpose in Debian.--- End Message ---


Bug#655359: marked as done (RFP: ltsp-cluster-agent-weblive -- WebLive plugin for ltsp-cluster-agent)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 04:13:03 -0400
with message-id <678b3b43-f6c3-fe5c-5264-c06f3efdc...@linux.com>
and subject line [closing] RFP: ltsp-cluster-agent-weblive -- WebLive plugin 
for ltsp-cluster-agent
has caused the Debian Bug report #655359,
regarding RFP: ltsp-cluster-agent-weblive -- WebLive plugin for 
ltsp-cluster-agent
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
655359: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=655359
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Owner: Jonathan Carter 
Severity: wishlist

*** Please type your report below this line ***

* Package name: ltsp-cluster-agent-weblive
  Version : 1.8
  Upstream Author : Stéphane Graber
* URL : https://launchpad.net/ltsp-cluster
* License : GNU GPL v2
  Programming Lang: Python
  Description : WebLive plugin for ltsp-cluster-agent


--- End Message ---
--- Begin Message ---
Closing this RFP, as the upstream project is no longer alive and these
packages would serve little purpose in Debian.--- End Message ---


Bug#655358: marked as done (RFP: ltsp-cluster-agent -- Generic python daemon for LTSP (core package))

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 04:13:50 -0400
with message-id <74825dd1-01e3-979d-52d0-61f3af719...@linux.com>
and subject line [closing] RFP: ltsp-cluster-agent -- Generic python daemon for 
LTSP (core package)
has caused the Debian Bug report #655358,
regarding RFP: ltsp-cluster-agent -- Generic python daemon for LTSP (core 
package)
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
655358: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=655358
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Owner: Jonathan Carter 
Severity: wishlist

*** Please type your report below this line ***

* Package name: ltsp-cluster-agent
  Version : 0.8
  Upstream Author : Stéphane Graber, Vincent Vinet
* URL : https://launchpad.net/ltsp-cluster
* License : GNU GPL v2
  Programming Lang: Python
  Description : Generic python daemon for LTSP (core package)


--- End Message ---
--- Begin Message ---
Closing this RFP, as the upstream project is no longer alive and these
packages would serve little purpose in Debian.--- End Message ---


Bug#834512: marked as done (ITP: google-android-platform-installers -- This is a packaged scripts that automatically downloads Google's Android SDK Platform packages and unpacks them into Debian-frien

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 08:00:10 +
with message-id 
and subject line Bug#834512: fixed in google-android-installers 1472023576
has caused the Debian Bug report #834512,
regarding ITP: google-android-platform-installers -- This is a packaged scripts 
that automatically downloads Google's Android SDK Platform packages and unpacks 
them into Debian-friendly paths.
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
834512: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=834512
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Severity: wishlist
Owner: Mouaad Aallam 

* Package name: google-android-platform-installers
  Version : 1470833400
  Upstream Author : Google, Inc
* URL : https://developer.android.com/index.html
* License : public-domain
  Programming Lang: C, Java, Bash, Python
  Description : This is a packaged scripts that automatically downloads 
Google's Android SDK Platform packages and unpacks them into Debian-friendly 
paths.
  Target  : contrib

Google's Android SDK Platform Installer
This package will download the Google's Android SDK Platform packages and
unpacks them into Debian-friendly paths.
.
Every Google's Android SDK Platform package includes android.jar file with
fully compliant Android library. In order to build an Android app, the SDK
platform must be specified as build target.
.
WARNING: Installing this Debian package causes archives to to be downloaded
from dl.google.com and/or from other suggested mirrors. The End User License
Agreement of this binary package is available at developer.android.com.
--- End Message ---
--- Begin Message ---
Source: google-android-installers
Source-Version: 1472023576

We believe that the bug you reported is fixed in the latest version of
google-android-installers, which is due to be installed in the Debian FTP 
archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 834...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Mouaad Aallam  (supplier of updated 
google-android-installers package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Tue, 19 Jul 2016 12:00:25 +
Source: google-android-installers
Binary: google-android-platform-24-installer 
google-android-platform-23-installer google-android-platform-22-installer 
google-android-platform-21-installer google-android-platform-20-installer 
google-android-platform-19-installer google-android-platform-18-installer 
google-android-platform-17-installer google-android-platform-16-installer 
google-android-platform-15-installer google-android-platform-14-installer 
google-android-platform-13-installer google-android-platform-12-installer 
google-android-platform-11-installer google-android-platform-10-installer 
google-android-platform-9-installer google-android-platform-8-installer 
google-android-platform-7-installer google-android-platform-6-installer 
google-android-platform-5-installer google-android-platform-4-installer 
google-android-platform-3-installer google-android-platform-2-installer 
google-android-ndk-installer google-android-build-tools-24-installer 
google-android-build-tools-23-installer
 google-android-build-tools-22-installer 
google-android-build-tools-21-installer google-android-build-tools-20-installer 
google-android-build-tools-19-installer google-android-build-tools-18-installer
 google-android-build-tools-17-installer
Architecture: source amd64 all
Version: 1472023576
Distribution: unstable
Urgency: medium
Maintainer: Android tools Maintainer 

Changed-By: Mouaad Aallam 
Description:
 google-android-build-tools-17-installer - Google build tools 17 for Android 
(aapt, aidl, dexdump, dx)
 google-android-build-tools-18-installer - Google build tools 18 for Android 
(aapt, aidl, dexdump, dx)
 google-android-build-tools-19-installer - Google build tools 19 for Android 
(aapt, aidl, dexdump, dx)
 google-android-build-tools-20-installer - Google build tools 20 for Android 
(aapt, aidl, dexdump, dx)
 google-android-build-tools-21-installer - Google build tools 21 for Android 
(aapt, aidl, dexdump, dx)
 google-android-build-tools-22-installer - Google build to

Bug#837611: marked as done (ITP: uctodata -- Data for ucto tokeniser)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 08:00:11 +
with message-id 
and subject line Bug#837611: fixed in uctodata 0.1.1-1
has caused the Debian Bug report #837611,
regarding ITP: uctodata -- Data for ucto tokeniser
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837611: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837611
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Severity: wishlist
Owner: Maarten van Gompel 

* Package name: uctodata
  Upstream Author : Centre for Language and Speech Technology, Radboud 
University Nijmegen
* URL : https://languagemachines.github.io/ucto
* License : GPL-3
  Programming Lang: C++
  Description : Data for Unicode Tokenizer

 Ucto can tokenize UTF-8 encoded text files (i.e. separate words from
 punctuation, split sentences, generate n-grams), and  offers several other
 basic preprocessing steps that make your text suited for further processing 
 such as indexing, part-of-speech tagging, or machine translation.

 This package provides necessary language-specific datafiles for running Ucto.

 Ucto was written by Maarten van Gompel and Ko van der Sloot.  Work on Ucto
 was funded by NWO, the Netherlands Organisation for Scientific Research,
 under the Implicit Linguistics project, the CLARIN-NL program, and the 
 CLARIAH project.

 Ucto is a product of the Centre of Language and Speech Technology (Radboud
 University Nijmegen), and previously the ILK Research Group (Tilburg
 University, The Netherlands).



This is a split from package ucto, which previously contained the data as well.

--

Maarten van Gompel
Centre for Language Studies
Radboud Universiteit Nijmegen

proy...@anaproy.nl
http://proycon.anaproy.nl
http://github.com/proycon

GnuPG key:  0x1A31555C  XMPP: proy...@anaproy.nl
Telegram:   proycon IRC: proycon (freenode)
Twitter:https://twitter.com/proycon
Bitcoin:1BRptZsKQtqRGSZ5qKbX2azbfiygHxJPsd
--- End Message ---
--- Begin Message ---
Source: uctodata
Source-Version: 0.1.1-1

We believe that the bug you reported is fixed in the latest version of
uctodata, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Maarten van Gompel  (supplier of updated uctodata package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA1

Format: 1.8
Date: Sat, 30 Jul 2016 18:01:00 +0200
Source: uctodata
Binary: uctodata
Architecture: source all
Version: 0.1.1-1
Distribution: unstable
Urgency: medium
Maintainer: Debian Science Team 

Changed-By: Maarten van Gompel 
Description:
 uctodata   - Data files for Ucto
Closes: 837611
Changes:
 uctodata (0.1.1-1) unstable; urgency=medium
 .
   * First release (split from ucto package)
 new mandatory dependency for ucto
 (Closes: #837611)
Checksums-Sha1:
 3fdd8196d85526d375c25b3c10181354ce6330c7 2013 uctodata_0.1.1-1.dsc
 1203c73cae45ece0762036c66f594ec16fedece8 85362 uctodata_0.1.1.orig.tar.gz
 72b312826a4bc23c43c80cbc324137b1d8a9368c 2012 uctodata_0.1.1-1.debian.tar.xz
 c7144c9187b17918520e20b70c4cafdeffacbce2 11690 uctodata_0.1.1-1_all.deb
Checksums-Sha256:
 2d2ac86042e7a70b082e71ba469269e475ce89afa23e996d2c9c4efcf6e4fe34 2013 
uctodata_0.1.1-1.dsc
 ce2458a7ca745a695e6417164433d0e289f439993eefd5d2e411fc70a5b4a267 85362 
uctodata_0.1.1.orig.tar.gz
 f34942d73949b599f8a1e78b45c1b6bc265836eabecdafc1c122d3fb470bd791 2012 
uctodata_0.1.1-1.debian.tar.xz
 670646bf3dc012eb991ab6b7746e4ef6e3665918cd4ec15e8e7fdedfbec9a5d2 11690 
uctodata_0.1.1-1_all.deb
Files:
 d04f58ac3b9974a345fe43c1de37c7eb 2013 science extra uctodata_0.1.1-1.dsc
 1f89bee38ebdadf06c99138ebcdbd0c2 85362 science extra uctodata_0.1.1.orig.tar.gz
 6610c4af4abde530a9e67b727b28a3d4 2012 science extra 
uctodata_0.1.1-1.debian.tar.xz
 c33e34e7c5e16c2bd28c706bc6bbd76b 11690 science extra uctodata_0.1.1-1_all.deb

-BEGIN PGP SIGNATURE-
Version: GnuPG v1

iQIcBAEBAgAGBQJX2DZXAAoJENPhc4PPp/8GmEEP/27NL4BbytKAAf8N5IRs8cSj
CZAEVP4p8p6coSf7ND4OhGxYEEdQ/LumXJFV2aebY0IIPBaVtoQXw17WiuI7EVyz
+g2m/hhSJawDWrWnyNef9XPlquycH0jWvtE/BE89ivHVDDrOG1Qr4NYB78QRPz5b
NLKnTFCs7/Jc8KGMrj9S/7Z03HMUx4

Bug#837600: marked as done (ITP: r-bioc-phyloseq -- GNU R handling and analysis of high-throughput microbiome census data)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 08:00:10 +
with message-id 
and subject line Bug#837600: fixed in r-bioc-phyloseq 1.16.2-1
has caused the Debian Bug report #837600,
regarding ITP: r-bioc-phyloseq -- GNU R handling and analysis of 
high-throughput microbiome census data
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837600: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837600
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: wnpp
Severity: wishlist
Owner: Andreas Tille 

* Package name: r-bioc-phyloseq
  Version : 1.16.2
  Upstream Author : Paul J. McMurdie 
* URL : 
http://bioconductor.org/packages/release/bioc/html/phyloseq.html
* License : AGPL
  Programming Lang: GNU R
  Description : GNU R handling and analysis of high-throughput microbiome 
census data
 The Bioconductor module phyloseq provides a set of classes and tools to
 facilitate the import, storage, analysis, and graphical display of
 microbiome census data.


Remark: This package will be maintained by the Debian Med team at
  svn://anonscm.debian.org/debian-med/trunk/packages/R/r-bioc-phyloseq/trunk/
--- End Message ---
--- Begin Message ---
Source: r-bioc-phyloseq
Source-Version: 1.16.2-1

We believe that the bug you reported is fixed in the latest version of
r-bioc-phyloseq, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 837...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Andreas Tille  (supplier of updated r-bioc-phyloseq package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA256

Format: 1.8
Date: Tue, 13 Sep 2016 07:39:43 +0200
Source: r-bioc-phyloseq
Binary: r-bioc-phyloseq
Architecture: source all
Version: 1.16.2-1
Distribution: unstable
Urgency: low
Maintainer: Debian Med Packaging Team 

Changed-By: Andreas Tille 
Description:
 r-bioc-phyloseq - GNU R handling and analysis of high-throughput microbiome 
census
Closes: 837600
Changes:
 r-bioc-phyloseq (1.16.2-1) unstable; urgency=low
 .
   * Initial release (closes: #837600)
Checksums-Sha1:
 c07b60459b35d0b2e280d6ca399f2c5ac4ec3202 2318 r-bioc-phyloseq_1.16.2-1.dsc
 0b7aee0dfa74815006ecf072c47302571ce36aac 3275394 
r-bioc-phyloseq_1.16.2.orig.tar.gz
 81597eac87bc269aae3494092e2ec385ee03ab03 12712 
r-bioc-phyloseq_1.16.2-1.debian.tar.xz
 f65b8b3c4fd2302629453f3e0c21320e05614f2a 3122528 
r-bioc-phyloseq_1.16.2-1_all.deb
Checksums-Sha256:
 2ec7a4a8023bcdfc26bcfd984295a033238692c49bb6e888636cd2fea66feba5 2318 
r-bioc-phyloseq_1.16.2-1.dsc
 f8b14e39143cd1aa36910f55940b1784a94b5a56f6d84aab08d4ea37594f068a 3275394 
r-bioc-phyloseq_1.16.2.orig.tar.gz
 9d983f3e69ba61cb7f29e7cbf0e96018f282492284144ffb6154dc513d001147 12712 
r-bioc-phyloseq_1.16.2-1.debian.tar.xz
 e9608246200d09135f2d049892633303baa92b0bc0bc514bc7950558bce2aa5f 3122528 
r-bioc-phyloseq_1.16.2-1_all.deb
Files:
 82df4dae66795bec686e7df2740feb52 2318 gnu-r optional 
r-bioc-phyloseq_1.16.2-1.dsc
 f2975a42a005d6537820d8ff67bceba6 3275394 gnu-r optional 
r-bioc-phyloseq_1.16.2.orig.tar.gz
 1c118b43727fdf36c7f93a2157a61d4a 12712 gnu-r optional 
r-bioc-phyloseq_1.16.2-1.debian.tar.xz
 eb7e10b7063de8cc55db2cd5168a59e7 3122528 gnu-r optional 
r-bioc-phyloseq_1.16.2-1_all.deb

-BEGIN PGP SIGNATURE-
Version: GnuPG v1

iQIcBAEBCAAGBQJX15QaAAoJEFeKBJTRxkbRlkQP/ROuCbdl3eQRnGtixhLJ77OG
7iOwMiPWd/CMFTqzycY4AmT6zBz2ukkWyK2kvu5bKV8XrA/4bklvMazdnRFii/I9
ZcVV3sNM18dqSK605RuTdwdCrxOcC/gV8Ni4lIhFE2jlK1A23Jhd3/7hFAW7Ej9d
xi6CPsEA40OEJ22RHLNDQKqYb1VeQrgtn08XOWxyUoGw9ySk+X+cq+XMMQ+Nbcrw
kO5K20B+tc76S669XmW3L4ps09p77D7o6dMQ7lJcXmfcRURwi8oDqoUfsKrBtkXI
YNakhs7qjpWfOQzMx1bnkkgsijivJLFdTsFGCwY0LtgWLhKIUNl2I35zsnCFHCZ4
BGbX3fNbe3kCGPq5LjCDI/sJDCFraz3oH0bWZF15jhPXyPHpp5xK7G2uqBhtXaB0
dAiA+nRdtRh199lsYgrbUCB5p8/pzlbnOZSTIrnV3D+h/+Rk92zQKs0MjyntgmnR
jaxv2xdH3eAWbUssj+Fy0nd8AkDx7JkWRW/Mv3rwP6uOnhksudImdbN89AKDCwCq
W7+6yFjmkwjVShBqe04EhnywnJDs9fYZ41pHB6Ay3qyFEECJJN5Hl3nC9kzglFgl
FHUXi69rBGezN4aqex6hpJzqBXdMlZeJoF37qPuP6qc/5aQ1PpeTZf06wj4Z6nwg
SQA/uv9KdkLi1qBggz/k
=FGCZ
-END PGP SIGNATURE End Message ---


Bug#835284: marked as done (urdfdom: FTBFS: Could not find a configuration file for package "urdfdom_headers" that is 367 compatible with requested version "0.4".)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:42:42 +0200
with message-id 
and subject line urdfdom: FTBFS: Could not find a configuration file for 
package "urdfdom_headers" that is 367 compatible with requested version "0.4".
has caused the Debian Bug report #835284,
regarding urdfdom: FTBFS: Could not find a configuration file for package 
"urdfdom_headers" that is 367 compatible with requested version "0.4".
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
835284: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=835284
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: urdfdom
Version: 0.4.1-1
Severity: serious
Justification: fails to build from source
User: reproducible-bui...@lists.alioth.debian.org
Usertags: ftbfs
X-Debbugs-Cc: reproducible-bui...@lists.alioth.debian.org

Dear Maintainer,

urdfdom fails to build from source in unstable/amd64:

  [..]

  CMAKE_INSTALL_LIBDIR:PATH=lib/x86_64-linux-gnu
  
  //program executables (libexec)
  CMAKE_INSTALL_LIBEXECDIR:PATH=libexec
  
  //locale-dependent data (DATAROOTDIR/locale)
  CMAKE_INSTALL_LOCALEDIR:PATH=
  
  //No help, variable specified on the command line.
  CMAKE_INSTALL_LOCALSTATEDIR:UNINITIALIZED=/var
  
  //man documentation (DATAROOTDIR/man)
  CMAKE_INSTALL_MANDIR:PATH=
  
  //C header files for non-gcc (/usr/include)
  CMAKE_INSTALL_OLDINCLUDEDIR:PATH=/usr/include
  
  //Install path prefix, prepended onto install directories.
  CMAKE_INSTALL_PREFIX:PATH=/usr
  
  //system admin executables (sbin)
  CMAKE_INSTALL_SBINDIR:PATH=sbin
  
  //modifiable architecture-independent data (com)
  CMAKE_INSTALL_SHAREDSTATEDIR:PATH=com
  
  //No help, variable specified on the command line.
  CMAKE_INSTALL_SYSCONFDIR:UNINITIALIZED=/etc
  
  //Path to a program.
  CMAKE_LINKER:FILEPATH=/usr/bin/ld
  
  //Path to a program.
  CMAKE_MAKE_PROGRAM:FILEPATH=/usr/bin/make
  
  //Flags used by the linker during the creation of modules.
  CMAKE_MODULE_LINKER_FLAGS:STRING= -Wl,-z,relro
  
  //Flags used by the linker during debug builds.
  CMAKE_MODULE_LINKER_FLAGS_DEBUG:STRING=
  
  //Flags used by the linker during release minsize builds.
  CMAKE_MODULE_LINKER_FLAGS_MINSIZEREL:STRING=
  
  //Flags used by the linker during release builds.
  CMAKE_MODULE_LINKER_FLAGS_RELEASE:STRING=
  
  //Flags used by the linker during Release with Debug Info builds.
  CMAKE_MODULE_LINKER_FLAGS_RELWITHDEBINFO:STRING=
  
  //Path to a program.
  CMAKE_NM:FILEPATH=/usr/bin/nm
  
  //Path to a program.
  CMAKE_OBJCOPY:FILEPATH=/usr/bin/objcopy
  
  //Path to a program.
  CMAKE_OBJDUMP:FILEPATH=/usr/bin/objdump
  
  //Value Computed by CMake
  CMAKE_PROJECT_NAME:STATIC=urdfdom
  
  //Path to a program.
  CMAKE_RANLIB:FILEPATH=/usr/bin/ranlib
  
  //Flags used by the linker during the creation of dll's.
  CMAKE_SHARED_LINKER_FLAGS:STRING= -Wl,-z,relro
  
  //Flags used by the linker during debug builds.
  CMAKE_SHARED_LINKER_FLAGS_DEBUG:STRING=
  
  //Flags used by the linker during release minsize builds.
  CMAKE_SHARED_LINKER_FLAGS_MINSIZEREL:STRING=
  
  //Flags used by the linker during release builds.
  CMAKE_SHARED_LINKER_FLAGS_RELEASE:STRING=
  
  //Flags used by the linker during Release with Debug Info builds.
  CMAKE_SHARED_LINKER_FLAGS_RELWITHDEBINFO:STRING=
  
  //If set, runtime paths are not added when installing shared libraries,
  // but are added when building.
  CMAKE_SKIP_INSTALL_RPATH:BOOL=NO
  
  //If set, runtime paths are not added when using shared libraries.
  CMAKE_SKIP_RPATH:BOOL=NO
  
  //Flags used by the linker during the creation of static libraries.
  CMAKE_STATIC_LINKER_FLAGS:STRING=
  
  //Flags used by the linker during debug builds.
  CMAKE_STATIC_LINKER_FLAGS_DEBUG:STRING=
  
  //Flags used by the linker during release minsize builds.
  CMAKE_STATIC_LINKER_FLAGS_MINSIZEREL:STRING=
  
  //Flags used by the linker during release builds.
  CMAKE_STATIC_LINKER_FLAGS_RELEASE:STRING=
  
  //Flags used by the linker during Release with Debug Info builds.
  CMAKE_STATIC_LINKER_FLAGS_RELWITHDEBINFO:STRING=
  
  //Path to a program.
  CMAKE_STRIP:FILEPATH=/usr/bin/strip
  
  //If this value is on, makefiles will be generated without the
  // .SILENT directive, and all commands will be echoed to the console
  // during the make.  This is useful for debugging only. With Visual
  // Studio IDE projects all commands are done without /nologo.
  CMAKE_VERBOSE_MAKEFILE:BOOL=ON
  
  //Path to a file.
  TinyXML_INCLUDE_DIR:PATH=/usr/include
  
  //Path to a library.
  TinyXML_LIBRARY:FILEPATH=/usr/lib/x86_64-linux-gnu/libtinyxml.so
  
  //Value 

Bug#652955: marked as done ([linux-headers-3.1.0-1-common] Naming inconsistancy? can cause dkms/m-a problems)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:25:43 +0200
with message-id <6c777f72-7850-5de9-ff69-5d48c9491...@debian.org>
and subject line Re: [linux-headers-3.1.0-1-common] Naming inconsistancy? can 
cause dkms/m-a problems
has caused the Debian Bug report #652955,
regarding [linux-headers-3.1.0-1-common] Naming inconsistancy? can cause 
dkms/m-a problems
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
652955: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=652955
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: linux-headers-3.1.0-1-common
Version: 3.1.5-1
Severity: normal

--- Please enter the report below this line. ---
I am not sure this package has the bug but here goes:
If I have the same kernel version installed for both i686 and amd64, for 
example. The debian nvidia kernel modules will dkms successfully on both while 
the debian virtualbox kernel modules will dkms only for one of them. I would 
assume this applies to m-a as well since going to /usr/src and doing make (OK) 
and sudo make install (FAILS do to architecture inconstancy).

If there be differing linux-headers-common for differing architectures, 
they would need unique packaging just as the headers themselves.

Maybe this is not the problem and someone more knowledgable could accomplish 
as simple work-around, i.e. with some EXPORT=

Worth a look.


--- System information. ---
Architecture: i386
Kernel:   Linux 3.1.0-1-686-pae

Debian Release: wheezy/sid
  500 unstableftp.us.debian.org 
  500 testing ftp.us.debian.org 
1 experimentalftp.us.debian.org 

--- Package information. ---
Package's Depends field is empty.

Package's Recommends field is empty.

Package's Suggests field is empty.





--- End Message ---
--- Begin Message ---
Hi,


> The orginal bug reported, lack of a unique linux-headers common that might be 
> needed for differing archs, is still a question.
> 

I think newer virtualbox are good wrt this issue.

G.



signature.asc
Description: OpenPGP digital signature
--- End Message ---


Bug#634042: marked as done (Please explain that -source and -dkms are alternatives)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:29:00 +0200
with message-id <2ef1a921-5439-3ee8-6a35-26137495c...@debian.org>
and subject line Re: Please explain that -source and -dkms are alternatives
has caused the Debian Bug report #634042,
regarding Please explain that -source and -dkms are alternatives
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
634042: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=634042
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: virtualbox-source
Version: 4.0.10-dfsg-1
Severity: minor

I have virtualbox, -dkms and -qt installed.  I noticed a -source
package and wondered if I needed it, or would derive some benefit
from installing it.

After some research I concluded that -dkms and -source are
alternatives to each other: if you have one you don't need the other.
It would be helpful if this information were included in the long
descriptions of the two packages.

Thanks,
-- 
Thomas Hood


--- End Message ---
--- Begin Message ---
On Sat, 16 Jul 2011 11:26:21 +0200 Thomas Hood  wrote:
> Package: virtualbox-source
> Version: 4.0.10-dfsg-1
> Severity: minor
> 
> I have virtualbox, -dkms and -qt installed.  I noticed a -source
> package and wondered if I needed it, or would derive some benefit
> from installing it.
> 
> After some research I concluded that -dkms and -source are
> alternatives to each other: if you have one you don't need the other.
> It would be helpful if this information were included in the long
> descriptions of the two packages.
> 

fixed since a lot of time.

> Thanks,
> -- 
> Thomas Hood
> 
> 
> 



signature.asc
Description: OpenPGP digital signature
--- End Message ---


Bug#800421: marked as done (virtualbox: Starting Virtualbox Kernel Modules: No suitable module for the running Kernel found)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:17:53 +0200
with message-id 
and subject line Re: Bug#800421: virtualbox: Starting Virtualbox Kernel 
Modules: No suitable module for the running Kernel found
has caused the Debian Bug report #800421,
regarding virtualbox: Starting Virtualbox Kernel Modules: No suitable module 
for the running Kernel found
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
800421: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=800421
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: virtualbox
Version: 5.0.4-dfsg-2
Severity: important

Dear Maintainer,

*** Reporter, please consider answering these questions, where appropriate ***

   * What led up to the situation?

Starting debian

   * What exactly did you do (or not do) that was effective (or
 ineffective)?

Nothing to be mentioned

   * What was the outcome of this action?

Debian cannot start competly

   * What outcome did you expect instead?

Nothing special

*** End of the template - remove these template lines ***


-- System Information:
Debian Release: stretch/sid
  APT prefers testing
  APT policy: (650, 'testing'), (600, 'unstable'), (500, 'oldstable-updates'), 
(500, 'oldstable')
Architecture: i386 (i686)

Kernel: Linux 4.1.0-2-686-pae (SMP w/2 CPU cores)
Locale: LANG=de_AT.UTF-8, LC_CTYPE=de_AT.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages virtualbox depends on:
ii  adduser  3.113+nmu3
ii  dpkg 1.18.3
ii  libc62.19-22
ii  libcurl3-gnutls  7.44.0-2
ii  libgcc1  1:5.2.1-17
ii  libgsoap72.8.22-1
ii  libpng12-0   1.2.50-2+b2
ii  libpython2.7 2.7.10-4
ii  libsdl1.2debian  1.2.15-11
ii  libssl1.0.0  1.0.2d-1
ii  libstdc++6   5.2.1-17
ii  libvncserver10.9.10+dfsg-3
ii  libvpx2  1.4.0-4
ii  libx11-6 2:1.6.3-1
ii  libxcursor1  1:1.1.14-1+b1
ii  libxext6 2:1.3.3-1
ii  libxml2  2.9.2+zdfsg1-4
ii  libxmu6  2:1.1.2-1
ii  libxt6   1:1.1.4-1+b1
ii  python   2.7.9-1
ii  python2.72.7.10-4
pn  python:any   
ii  zlib1g   1:1.2.8.dfsg-2+b1

Versions of packages virtualbox recommends:
ii  libgl1-mesa-glx [libgl1] 10.6.8-1
ii  libqt4-opengl4:4.8.7+dfsg-3
ii  libqtcore4   4:4.8.7+dfsg-3
ii  libqtgui44:4.8.7+dfsg-3
pn  virtualbox-dkms | virtualbox-source  
ii  virtualbox-qt5.0.4-dfsg-2

Versions of packages virtualbox suggests:
ii  vde22.3.2+r586-2
ii  virtualbox-guest-additions-iso  5.0.4-1

-- Configuration Files:
/etc/default/virtualbox changed:
LOAD_VBOXDRV_MODULE=1
SHUTDOWN_USERS="yx"
SHUTDOWN=poweroff


-- no debconf information

Hope that could help.
--- End Message ---
--- Begin Message ---
On Tue, 29 Sep 2015 10:42:31 + (UTC) Gianfranco Costamagna 
 wrote:
> Control: fixed -1 5.0.4-dfsg-4
> 

closing

> Hi,
> 
> how did you install virtualbox?
> 
> You missed virtualbox-dkms package.
> 
> I'm closing since this should be fixed in the -4 revision
> (currently in new queue)
> 
> cheers,
> 
> G.
> 
> 
> Il Martedì 29 Settembre 2015 8:48, Thomas Schmidt  ha 
> scritto:
> Package: virtualbox
> Version: 5.0.4-dfsg-2
> Severity: important
> 
> Dear Maintainer,
> 
> *** Reporter, please consider answering these questions, where appropriate ***
> 
>* What led up to the situation?
> 
> Starting debian
> 
>* What exactly did you do (or not do) that was effective (or
>  ineffective)?
> 
> Nothing to be mentioned
> 
>* What was the outcome of this action?
> 
> Debian cannot start competly
> 
>* What outcome did you expect instead?
> 
> Nothing special
> 
> *** End of the template - remove these template lines ***
> 
> 
> -- System Information:
> Debian Release: stretch/sid
>   APT prefers testing
>   APT policy: (650, 'testing'), (600, 'unstable'), (500, 
> 'oldstable-updates'), (500, 'oldstable')
> Architecture: i386 (i686)
> 
> Kernel: Linux 4.1.0-2-686-pae (SMP w/2 CPU cores)
> Locale: LANG=de_AT.UTF-8, LC_CTYPE=de_AT.UTF-8 (charmap=UTF-8)
> Shell: /bin/sh linked to /bin/dash
> Init: systemd (via /run/systemd/system)
> 
> Versions of packages virtualbox depends on:
> ii  adduser  3.113+nmu3
> ii  dpkg 1.18.3
> ii  libc62.19-22



signature.asc
Description: OpenPGP digital signature
--- End Message ---


Bug#837526: marked as done (libshibsp7: needs rebuild before testing migration)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:19:47 +0200
with message-id <878tuv7xt8@lant.ki.iif.hu>
and subject line The rebuild is done
has caused the Debian Bug report #837526,
regarding libshibsp7: needs rebuild before testing migration
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837526: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837526
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: shibboleth-sp2-common
Version: 2.6.0+dfsg1-3
Severity: important
Tags: patch

Dear Maintainer,

   * What led up to the situation?

  Updated shibboleth from previous 2.5.x; two packages refused to
install due to configuration errors.


   * What was the result of updating?

 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : fatal error
on line 0, column 0, message: unable to open primary document entity
'/catalog.xml'
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : catalog
loader caught exception: XML error(s) during parsing, check log for
specifics
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : fatal error
on line 0, column 0, message: unable to open primary document entity
'/saml20-catalog.xml'
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : catalog
loader caught exception: XML error(s) during parsing, check log for
specifics
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : fatal error
on line 0, column 0, message: unable to open primary document entity
'/saml11-catalog.xml'
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : catalog
loader caught exception: XML error(s) during parsing, check log for
specifics
 2016-09-06 17:31:45 WARN XMLTooling.ParserPool : warning on
line 0, column 0, message: unable to open primary document entity
'/usr/share/xml/shibboleth/xmldsig-core-schema.xsd'
 2016-09-06 17:31:45 WARN XMLTooling.ParserPool : warning on
line 0, column 0, message: unable to open primary document entity
'/usr/share/xml/shibboleth/xml.xsd'
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : error on
line 143, column 56, message: namespace
'http://www.w3.org/XML/1998/namespace' is referenced without import
declaration
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : error on
line 254, column 56, message: namespace
'http://www.w3.org/2000/09/xmldsig#' is referenced without import
declaration
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : error on
line 254, column 56, message: referenced element 'ds:Signature' not
found
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : error on
line 277, column 31, message: namespace
'http://www.w3.org/2000/09/xmldsig#' is referenced without import
declaration
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : error on
line 277, column 31, message: referenced element 'ds:KeyInfo' not
found
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : error on
line 291, column 48, message: namespace
'http://www.w3.org/2000/09/xmldsig#' is referenced without import
declaration
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : error on
line 291, column 48, message: referenced element 'ds:Signature' not
found
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : fatal error
on line 1, column 1, message: invalid document structure
 2016-09-06 17:31:45 ERROR XMLTooling.ParserPool : fatal error
on line 9, column 154, message: fatal error during schema scan
 2016-09-06 17:31:45 ERROR Shibboleth.Config : error while
loading resource (/etc/shibboleth/shibboleth2.xml): XML error(s)
during parsing, check log for specifics
 2016-09-06 17:31:45 FATAL Shibboleth.Config : caught
exception while loading configuration: XML error(s) during parsing,
check log for specifics
 <3>configuration is invalid, check console for specific problems


   * What exactly did you do to try and address the situation?

  I used "/usr/sbin/shibd -t" to test the configuration changes I
added this to console.logger to debug the problem:

 log4j.category.XMLTooling.ParserPool=DEBUG

  Finally, modified the /usr/share/xml/shibboleth/catalog.xml file
to add the six required lines:

 http://www.w3.org/XML/1998/namespace";
uri="/usr/share/xml/xmltooling/xml.xsd"/>
 http://www.w3.org/2001/04/xmlenc#";
uri="/usr/share/xml/xmltooling/xenc-schema.xsd"/>
 http://www.w3.org/2000/09/xmldsig#";
uri="/usr/share/xml/xmltooling/xmldsig-core-schema.xsd"/>

 
 
 


   * What was the outcome from this action?

  The service started successfully, despite some suspicious err

Bug#836600: marked as done (openal-soft FTCBFS: uses the build architecture compiler)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 07:20:22 +
with message-id 
and subject line Bug#836600: fixed in openal-soft 1:1.17.2-2
has caused the Debian Bug report #836600,
regarding openal-soft FTCBFS: uses the build architecture compiler
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
836600: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836600
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: openal-soft
Version: 1:1.17.2-1
Tags: patch
User: helm...@debian.org
Usertags: rebootstrap

openal-soft fails to cross build from source, because it does not pass
cross tools to cmake and thus uses the build architecture compiler. In
the end, dh_strip fails operating on the generated objects with host
architecture tools.

I am attaching a patch that makes openal-soft cross buildable. I added
the --builddirectory flag to dh to be able to use dh_auto_configure,
which knows the required cross flags. That allows removing the
dh_auto_build override, which in turn makes parallel builds actually
work. I also had to replace the explicit cc invocations with
triplet-prefixed versions. In the end, the patch turned out simplifying
the build. I hope you can apply it as is.

Helmut
diff --minimal -Nru openal-soft-1.17.2/debian/changelog 
openal-soft-1.17.2/debian/changelog
--- openal-soft-1.17.2/debian/changelog 2016-03-21 09:04:11.0 +0100
+++ openal-soft-1.17.2/debian/changelog 2016-09-04 08:04:18.0 +0200
@@ -1,3 +1,13 @@
+openal-soft (1:1.17.2-1.1) UNRELEASED; urgency=medium
+
+  * Non-maintainer upload.
+  * Fix FTCBFS: (Closes: #-1)
++ Invoke cmake via dh_auto_configure
++ Pass --builddirectory to dh
++ Invoke triplet-prefixed CC from d/rules
+
+ -- Helmut Grohne   Sun, 04 Sep 2016 07:59:01 +0200
+
 openal-soft (1:1.17.2-1) unstable; urgency=medium
 
   * Team upload
diff --minimal -Nru openal-soft-1.17.2/debian/rules 
openal-soft-1.17.2/debian/rules
--- openal-soft-1.17.2/debian/rules 2016-03-21 09:04:11.0 +0100
+++ openal-soft-1.17.2/debian/rules 2016-09-04 14:16:52.0 +0200
@@ -10,14 +10,13 @@
 CXXFLAGS:=$(shell dpkg-buildflags --get CXXFLAGS) $(CPPFLAGS)
 LDFLAGS:=$(shell dpkg-buildflags --get LDFLAGS)
 
-DEB_HOST_ARCH_OS ?= $(shell dpkg-architecture -qDEB_HOST_ARCH_OS)
-
-# For multiarch
-DEB_HOST_MULTIARCH ?= $(shell dpkg-architecture -qDEB_HOST_MULTIARCH)
+include /usr/share/dpkg/architecture.mk
+ifeq ($(origin CC),default)
+   CC = $(DEB_HOST_GNU_TYPE)-gcc
+endif
 
 # Use this variable to allow options passed to cmake to be overridable
 DEB_CMAKE_OPTIONS ?= -DCMAKE_VERBOSE_MAKEFILE=ON \
-   -DCMAKE_INSTALL_PREFIX="/usr" \
-DLIB_SUFFIX="/$(DEB_HOST_MULTIARCH)" \
-DEXAMPLES=OFF \
..
@@ -32,18 +31,13 @@
 
 .PHONY: build
 %:
-   dh $@ --parallel
-
-build:
-   dh $@ --parallel
+   dh $@ --builddirectory=$(BUILD_TREE) --parallel
 
 override_dh_auto_clean:
rm -rf $(BUILD_TREE)
 
 override_dh_auto_configure:
-   mkdir -p $(BUILD_TREE)
-   cd $(BUILD_TREE) && \
-   cmake $(DEB_CMAKE_OPTIONS)
+   dh_auto_configure -- $(DEB_CMAKE_OPTIONS)
 
 override_dh_installchangelogs:
dh_installchangelogs ChangeLog 
@@ -56,11 +50,8 @@
${MAKE} -f /usr/share/cdbs/1/rules/utils.mk debian/stamp-copyright-check
rm debian/stamp-copyright-check
 
-override_dh_auto_build:
-   $(MAKE) --directory=$(BUILD_TREE)
-
 override_dh_auto_install:
-   $(MAKE) --directory=$(BUILD_TREE) install DESTDIR=$(CURDIR)/debian/tmp
+   dh_auto_install
install -d debian/tmp/etc/openal
install -m644 \
debian/tmp/usr/share/openal/alsoftrc.sample \
@@ -75,11 +66,11 @@
 
 debian/tmp/openal-soft-Recommends-dummy.so:
mkdir -p debian/tmp
-   cc -xc -shared -Wl,--no-as-needed -o $@ /dev/null 
$(DLOPENED_RECOMMENDS_LIBS)
+   $(CC) -xc -shared -Wl,--no-as-needed -o $@ /dev/null 
$(DLOPENED_RECOMMENDS_LIBS)
 
 debian/tmp/openal-soft-Suggests-dummy.so:
mkdir -p debian/tmp
-   cc -xc -shared -Wl,--no-as-needed -o $@ /dev/null 
$(DLOPENED_SUGGESTS_LIBS)
+   $(CC) -xc -shared -Wl,--no-as-needed -o $@ /dev/null 
$(DLOPENED_SUGGESTS_LIBS)
 
 get-orig-source:
$(dir $_)openal-soft-get-orig-source
--- End Message ---
--- Begin Message ---
Source: openal-soft
Source-Version: 1:1.17.2-2

We believe that the bug you reported is fixed in the latest version of
openal-soft, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attache

Bug#755527: marked as done (virtualbox: Cannot install via aptitude - depends libgsoap4 missing)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:19:24 +0200
with message-id <4de1406a-d24e-da76-8329-b53c1fdbb...@debian.org>
and subject line Re: libgsoap4 missing
has caused the Debian Bug report #755527,
regarding virtualbox: Cannot install via aptitude - depends libgsoap4 missing
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
755527: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=755527
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: virtualbox
Severity: important

Dear Maintainer,

I tried to "aptitude install virtualbox" and it did not work, because it
required libgsoap4 for a dependency, but it is missing.

Neither apt-get nor aptitude would install it. There is no candidate for it.

I tried to install libgsoap4 itself, but couldn't.


-- System Information:
Debian Release: jessie/sid
  APT prefers unstable
  APT policy: (500, 'unstable')
Architecture: amd64 (x86_64)

Kernel: Linux 3.14-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=en_US.UTF-8, LC_CTYPE=en_US.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
--- End Message ---
--- Begin Message ---
On Sat, 26 Jul 2014 13:11:58 +1000 Stephen Thomas  
wrote:
> The issue appears to be that the testing repository currently only
> contains an i386 package for libgsoap4. Fortunately it seems that the
> amd64 version in the wheezy-backports repository works, so until the
> testing repo is fixed you can use that:
> 
> su - || sudo -i
> echo deb http://cdn.debian.net/debian/ wheezy-backports main
> >/etc/apt/sources.list.d/wheezy-backports.list
> aptitude update


probably you were in the middle of a gsoap transition

G.

> 
> 



signature.asc
Description: OpenPGP digital signature
--- End Message ---


Bug#837389: marked as done (gnome-multi-writer: It causes segfault with "start copying")

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 16:18:47 +0900
with message-id <20160914161847.42f827f93b2d105271ea2...@debian.or.jp>
and subject line fixed in 3.21.92-1
has caused the Debian Bug report #837389,
regarding gnome-multi-writer: It causes segfault with "start copying"
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
837389: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=837389
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: gnome-multi-writer
Version: 3.21.91-1
Severity: important

Dear Maintainer,

 gnome-multi-writer doesn't work since 3.21.91-1.
 Clicking "Start Copying" just gets segfault.

(gdb) run  
Starting program: /usr/bin/gnome-multi-writer 
[Thread debugging using libthread_db enabled]
Using host libthread_db library "/lib/x86_64-linux-gnu/libthread_db.so.1".
[New Thread 0x7fffec9f2700 (LWP 11614)]
[New Thread 0x7fffec1f1700 (LWP 11615)]
[New Thread 0x7fffeb5dd700 (LWP 11616)]
[New Thread 0x7fffeaddc700 (LWP 11617)]
[New Thread 0x7fffea5db700 (LWP 11618)]
[New Thread 0x7fffe9dda700 (LWP 11619)]

Thread 1 "gnome-multi-wri" received signal SIGSEGV, Segmentation fault.
0x7669605e in g_permission_get_allowed (permission=0x559e05a0) at 
././gio/gpermission.c:267
267 ././gio/gpermission.c: No such file or directory.
(gdb) 


-- System Information:
Debian Release: stretch/sid
  APT prefers unstable
  APT policy: (500, 'unstable'), (1, 'experimental')
Architecture: amd64 (x86_64)

Kernel: Linux 4.6.0-1-amd64 (SMP w/4 CPU cores)
Locale: LANG=ja_JP.UTF-8, LC_CTYPE=ja_JP.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash
Init: systemd (via /run/systemd/system)

Versions of packages gnome-multi-writer depends on:
ii  dconf-gsettings-backend [gsettings-backend]  0.26.0-1
ii  libc62.24-2
ii  libcanberra-gtk3-0   0.30-3
ii  libcanberra0 0.30-3
ii  libglib2.0-0 2.49.6-1
ii  libgtk-3-0   3.21.5-3
ii  libgudev-1.0-0   230-3
ii  libgusb2 0.2.9-1
ii  libpolkit-gobject-1-00.105-16
ii  libudisks2-0 2.1.7-2

gnome-multi-writer recommends no packages.

gnome-multi-writer suggests no packages.

-- no debconf information
--- End Message ---
--- Begin Message ---


-- 
Regards,

 Hideki Yamane henrich @ debian.or.jp/org
 http://wiki.debian.org/HidekiYamane--- End Message ---


Bug#808184: marked as done (openal-soft: could build sndio support again)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 07:20:22 +
with message-id 
and subject line Bug#808184: fixed in openal-soft 1:1.17.2-2
has caused the Debian Bug report #808184,
regarding openal-soft: could build sndio support again
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
808184: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=808184
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Source: openal-soft
Severity: wishlist
Tags: patch

Now that the "real" sndio implementation is packaged in Debian, openal
could build support for it again.

Playback works fine in my testing, but requires that sndio be specifically
enabled in alsoft.conf/.alsoftrc. I'm not sure if this should be documented
somewhere, or made more intuitive with a source patch.

diff --git a/debian/control b/debian/control
index e7a1f40..2247edc 100644
--- a/debian/control
+++ b/debian/control
@@ -7,7 +7,7 @@ Uploaders: Bruno "Fuddl" Kleinert ,
Bret Curtis 
 Build-Depends: debhelper (>= 9),
libasound2-dev [linux-any],
-   cmake, portaudio19-dev, libpulse-dev,
+   cmake, portaudio19-dev, libpulse-dev, libsndio-dev
 Standards-Version: 3.9.6
 Section: libs
 Vcs-Git: git://anonscm.debian.org/pkg-games/openal-soft.git
diff --git a/debian/rules b/debian/rules
index bf0ff68..56fef4e 100755
--- a/debian/rules
+++ b/debian/rules
@@ -28,7 +28,7 @@ DLOPENED_RECOMMENDS_LIBS = -lpulse
 ifeq ($(DEB_HOST_ARCH_OS),linux)
 DLOPENED_RECOMMENDS_LIBS += -lasound
 endif
-DLOPENED_SUGGESTS_LIBS = -lportaudio
+DLOPENED_SUGGESTS_LIBS = -lportaudio -lsndio
 
 .PHONY: build
 %:
--- End Message ---
--- Begin Message ---
Source: openal-soft
Source-Version: 1:1.17.2-2

We believe that the bug you reported is fixed in the latest version of
openal-soft, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 808...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Helmut Grohne  (supplier of updated openal-soft package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Sun, 04 Sep 2016 07:59:01 +0200
Source: openal-soft
Binary: libopenal-dev libopenal1 libopenal1-dbg openal-info makehrtf 
libopenal-data
Architecture: source all amd64
Version: 1:1.17.2-2
Distribution: unstable
Urgency: medium
Maintainer: Debian Games Team 
Changed-By: Helmut Grohne 
Description:
 libopenal-data - Software implementation of the OpenAL audio API (data files)
 libopenal-dev - Software implementation of the OpenAL audio API (development 
file
 libopenal1 - Software implementation of the OpenAL audio API (shared library)
 libopenal1-dbg - Software implementation of the OpenAL audio API (debug 
symbols)
 makehrtf   - HRTF Processing and Composition Utility
 openal-info - Informational utility for the OpenAL audio API
Closes: 680742 808184 836600
Changes:
 openal-soft (1:1.17.2-2) unstable; urgency=medium
 .
   [ Bret Curtis ]
   * add support back to sndio (Closes: #808184, #680742)
 .
   [ Helmut Grohne ]
   * Fix FTCBFS: (Closes: #836600)
 + Invoke cmake via dh_auto_configure
 + Pass --builddirectory to dh
 + Invoke triplet-prefixed CC from d/rules
Checksums-Sha1:
 1114ead633a25a6d913313c648a35afa4554a84f 2569 openal-soft_1.17.2-2.dsc
 284ee280a5a1323a194bc6c77554e02eca4435e3 12264 
openal-soft_1.17.2-2.debian.tar.xz
 c937f8e2bd8193398bd1f9a617b381079b3fc661 106674 libopenal-data_1.17.2-2_all.deb
 cf10f95f0da02d2af3aa0f40c4822e490b419a26 27742 libopenal-dev_1.17.2-2_amd64.deb
 a3ea31794872b9e2f2470e695e197efe73e036b1 576540 
libopenal1-dbg_1.17.2-2_amd64.deb
 019a57d171788a19168b7fe124514bfe232cfdee 211910 libopenal1_1.17.2-2_amd64.deb
 125bbde7ae242ac352715aa45fd054bfa76bf180 38064 
makehrtf-dbgsym_1.17.2-2_amd64.deb
 f001f5a461722be360153812cd23a23c9e7dd056 27978 makehrtf_1.17.2-2_amd64.deb
 3c6e311fe0f096a13d574d8109a62a406883e32b 9656 
openal-info-dbgsym_1.17.2-2_amd64.deb
 7d0f0cdacc19e5a138167c33c3375a5ee619b85b 15434 openal-info_1.17.2-2_amd64.deb
Checksums-Sha256:
 7ff20d16a9d3493ea09376e487e85507dd520342434c0de7cc0b324e64bfb0d4 2569 
openal-soft_1.17.2-2.dsc
 5313bd0ec75e148ef21a1cacf262769621e8c9cce5d708db7ec370b8379110a8 12264 
o

Bug#743291: marked as done (virtualbox-dkms: Kernel oops when loading module compiled by gcc 4.7)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:16:26 +0200
with message-id <05ba11bc-7d7a-4ab5-c4f6-f4e236a20...@debian.org>
and subject line Re: virtualbox-dkms: Kernel oops when loading module compiled 
by gcc 4.7
has caused the Debian Bug report #743291,
regarding virtualbox-dkms: Kernel oops when loading module compiled by gcc 4.7
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
743291: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=743291
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: virtualbox-dkms
Version: 4.1.18-dfsg-2+deb7u2
Severity: normal

Dear Maintainer,

When loading your own kernel modules (via virtualbox-dkms) compiled with 
gcc (Version: 4:4.7.2-1, from wheezy) on an i386 system, the system generates a
kernel oops and vitualbox can't be used.

Apparently, this is due to a compiler bug, for which upstream has
committed a workaround: https://www.virtualbox.org/changeset/44302/vbox#file0

It appears this is fixed in a later gcc version as well (see
http://gcc.gnu.org/bugzilla/show_bug.cgi?id=55940), but I would appreciate the
fix being included in the Debian packages - it appears to be a simple enough
fix that could help a lot of users.


For reference, here's a copy of a kernel oops generated by the faulty module:


BUG: unable to handle kernel NULL pointer dereference at 0900
IP: [] VBoxHost_RTR0MemObjFree+0x294/0x294 [vboxdrv]
*pdpt = 1af1b001 *pde =  
Oops:  [#1] SMP 
Modules linked in: vboxdrv(O+) des_generic ecb md4 hmac nls_utf8 cifs ppdev lp 
crc32c ib_iser rdma_cm ib_addr iw_cm ib_cm ib_sa ib_madi_tcp libiscsi_tcp 
libiscsi scsi_transport_iscsi nfsd nfs nfs_acl auth_rpcgss fscache lockd sunrpc 
ext4 crc16 jbd2 xt_tcpudp iptable_mangle xt_mark 8021q garp stp iptat 
nf_conntrack_ipv4 nf_defrag_ipv4 nf_conntrack ip_tables x_tables mptctl loop 
psmouse snd_pcm snd_page_alloc snd_timer snd soundcore via686a joydev serio_raw 
evdev pc2c_viapro i2c_core ibmasm processor parport_pc parport thermal_sys 
button ext3 mbcache jbd dm_mod md_mod microcode sd_mod crc_t10dif sg qla2xxx 
sr_mod cdrom scsi_transi scsi_transport_spi ata_generic mptscsih scsi_tgt tg3 
e1000 mptbase libphy floppy pata_via libata uhci_hcd ehci_hcd scsi_mod usbcore 
usb_common [last unloaded: scsi_wait_scan]

Pid: 25349, comm: modprobe Tainted: G   O 3.2.54 #1 IBM eserver xSeries 
445 -[88704RY]-/Node 1 SMP Module 1
EIP: 0060:[] EFLAGS: 00010293 CPU: 5
EIP is at VBoxHost_RTR0MemObjGetPagePhysAddr+0x0/0x67 [vboxdrv]
EAX: ed475000 EBX: ed475000 ECX: 2d475000 EDX: 0002
ESI: f8c11768 EDI: 0900 EBP:  ESP: d34d9e94
 DS: 007b ES: 007b FS: 00d8 GS: 00e0 SS: 0068
Process modprobe (pid: 25349, ti=d34d8000 task=f70aa880 task.ti=d34d8000)
Stack:
 f8bf308f f70bf310  f70bf310 00d0 c10c2a9b 0020 00d0
 0018 f8bf854b 0246  0008 d34d9eec 0018 f8bf854b
 0008  1000 00017719 f8c1b000 f8bf6cb7 d1ff2320 f8bf6cea
Call Trace:
 [] ? supdrvInitDevExt+0xdd/0x72d [vboxdrv]
 [] ? __kmalloc+0x92/0x9e
 [] ? rtR0MemAllocEx+0x69/0xbc [vboxdrv]
 [] ? rtR0MemAllocEx+0x69/0xbc [vboxdrv]
 [] ? 0xf8c1afff
 [] ? rtR0MemAlloc+0x8/0x15 [vboxdrv]
 [] ? VBoxHost_RTMemAllocTag+0xb/0x18 [vboxdrv]
 [] ? VBoxHost_RTSpinlockCreate+0xc/0x30 [vboxdrv]
 [] ? 0xf8c1afff
 [] ? VBoxDrvLinuxInit+0x50/0x1000 [vboxdrv]
 [] ? 0xf8c1afff
 [] ? do_one_initcall+0x66/0x10e
 [] ? 0xf8c1afff
 [] ? sys_init_module+0x1465/0x1644
 [] ? sysenter_do_call+0x12/0x28
Code: fe ff ff e9 cf fe ff ff 8b 4a 1c 85 c9 0f 84 47 ff ff ff 8d 34 8d fc ff 
ff ff 89 4c 24 04 e9 5c ff ff ff 83 c4 08 5b 5e 5f 5d c3
7 04 8d 91 00 10 00 00 81 fa ff 1f 00 00 76 45 81 39 
EIP: [] VBoxHost_RTR0MemObjGetPagePhysAddr+0x0/0x67 [vboxdrv] SS:ESP 
0068:d34d9e94
CR2: 0900
---[ end trace 2f3b2a25cd38b193 ]---


Kind regards,

Andreas Trottmann



-- System Information:
Debian Release: 7.4
  APT prefers stable-updates
  APT policy: (500, 'stable-updates'), (500, 'stable')
Architecture: i386 (i686)

Kernel: Linux 3.2.54 (SMP w/8 CPU cores)
Locale: LANG=en_US.UTF-8, LC_CTYPE=en_US.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash

Versions of packages virtualbox-dkms depends on:
ii  dkms2.2.0.3-1.2
ii  dpkg1.16.12
ii  virtualbox  4.1.18-dfsg-2+deb7u2

virtualbox-dkms recommends no packages.

virtualbox-dkms suggests no packages.

-- no debconf information
--- End Message ---
--- Begin Message ---
Hi

On Tue, 01 Apr 2014 15:31:32 +0200 "Andreas U. Trottmann" 
 wrote:
> Package: virtualbox-dkms
> Version: 4.1.18-dfsg-2+deb7u2
> Severity: normal
> 
> Dea

Bug#704429: marked as done (linux-image-3.2.0-4-amd64: Kernel oops)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:17:25 +0200
with message-id <64f4be36-313f-2b12-6d02-408491b15...@debian.org>
and subject line Re: Bug#704429: linux-image-3.2.0-4-amd64: Kernel oops
has caused the Debian Bug report #704429,
regarding linux-image-3.2.0-4-amd64: Kernel oops
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
704429: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=704429
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: src:linux
Version: 3.2.39-2
Severity: normal

Dear Maintainer,

I don't do something special as I can remember but I get a lot of these traces
in my kern.log.
My computer doesn't crash and I don't see any problem occuring.

Apr  1 02:39:01 station kernel: [538328.519489] BUG: unable to handle kernel
paging request at 00020430
Apr  1 02:39:01 station kernel: [538328.519493] IP: []
arch_vma_name+0xc/0x32
Apr  1 02:39:01 station kernel: [538328.519500] PGD 569e1067 PUD 569e0067 PMD 0
Apr  1 02:39:01 station kernel: [538328.519504] Oops:  [#5782] SMP
Apr  1 02:39:01 station kernel: [538328.519507] CPU 1
Apr  1 02:39:01 station kernel: [538328.519508] Modules linked in: bnep rfcomm
bluetooth rfkill tun xt_multiport iptable_filter ip_tables x_tables pci_stub
vboxpci(O) vboxnetadp(O) vboxnetflt(O) vboxdrv(O) binfmt_misc loop
snd_usb_audio snd_hda_codec_hdmi snd_usbmidi_lib snd_seq_midi
snd_seq_midi_event snd_rawmidi joydev snd_hda_codec_via snd_hda_intel
snd_hda_codec snd_hwdep snd_pcm snd_page_alloc iTCO_wdt iTCO_vendor_support
acpi_cpufreq snd_seq snd_seq_device snd_timer mperf i2c_i801 fglrx(P) snd
psmouse i2c_core serio_raw asus_atk0110 evdev pcspkr coretemp soundcore
processor thermal_sys button ext4 crc16 jbd2 mbcache sg sd_mod sr_mod cdrom
crc_t10dif ata_generic usbhid hid ahci libahci pata_marvell uhci_hcd libata
scsi_mod r8169 mii ehci_hcd usbcore usb_common [last unloaded: scsi_wait_scan]
Apr  1 02:39:01 station kernel: [538328.519556]
Apr  1 02:39:01 station kernel: [538328.519559] Pid: 6502, comm: fuser Tainted:
P  DO 3.2.0-4-amd64 #1 Debian 3.2.39-2 System manufacturer System
Product Name/P5QL
Apr  1 02:39:01 station kernel: [538328.519563] RIP: 0010:[]
[] arch_vma_name+0xc/0x32
Apr  1 02:39:01 station kernel: [538328.519568] RSP: 0018:880084875df0
EFLAGS: 00010206
Apr  1 02:39:01 station kernel: [538328.519570] RAX:  RBX:
880222fa8818 RCX: 880222fa8820
Apr  1 02:39:01 station kernel: [538328.519572] RDX: 00020100 RSI:
0011 RDI: 880222fa8818
Apr  1 02:39:01 station kernel: [538328.519574] RBP:  R08:
0002 R09: fffb
Apr  1 02:39:01 station kernel: [538328.519577] R10:  R11:
 R12: 00020100
Apr  1 02:39:01 station kernel: [538328.519579] R13: 8801f26fec40 R14:
 R15: 
Apr  1 02:39:01 station kernel: [538328.519582] FS:  7fab6e532700()
GS:88022fc8() knlGS:
Apr  1 02:39:01 station kernel: [538328.519584] CS:  0010 DS:  ES: 
CR0: 80050033
Apr  1 02:39:01 station kernel: [538328.519587] CR2: 00020430 CR3:
569f9000 CR4: 000406e0
Apr  1 02:39:01 station kernel: [538328.519589] DR0:  DR1:
 DR2: 
Apr  1 02:39:01 station kernel: [538328.519591] DR3:  DR6:
0ff0 DR7: 0400
Apr  1 02:39:01 station kernel: [538328.519594] Process fuser (pid: 6502,
threadinfo 880084874000, task 8801ca7b77d0)
Apr  1 02:39:01 station kernel: [538328.519596] Stack:
Apr  1 02:39:01 station kernel: [538328.519597]  8113e131
8802002d 0070 
Apr  1 02:39:01 station kernel: [538328.519602]  
8802  880084875e44
Apr  1 02:39:01 station kernel: [538328.519606]  8134c667
0246 00388134d287 8802239a9480
Apr  1 02:39:01 station kernel: [538328.519610] Call Trace:
Apr  1 02:39:01 station kernel: [538328.519614]  [] ?
show_map_vma+0x15d/0x200
Apr  1 02:39:01 station kernel: [538328.519618]  [] ?
_cond_resched+0x7/0x1c
Apr  1 02:39:01 station kernel: [538328.519621]  [] ?
show_map+0x17/0x44
Apr  1 02:39:01 station kernel: [538328.519624]  [] ?
seq_read+0x266/0x34c
Apr  1 02:39:01 station kernel: [538328.519628]  [] ?
vfs_read+0x9f/0xe6
Apr  1 02:39:01 station kernel: [538328.519630]  [] ?
sys_read+0x45/0x6b
Apr  1 02:39:01 station kernel: [538328.519634]  [] ?
system_call_fastpath+0x16/0x1b
Apr  1 02:39:01 station kernel: [

Bug#740267: marked as done (virtualbox-guest-dkms: Module not build on kernel: 3.12-0.bpo.1-amd64 (x86_64))

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:20:02 +0200
with message-id 
and subject line Re: virtualbox-guest-dkms: Module not build on kernel: 
3.12-0.bpo.1-amd64 (x86_64)
has caused the Debian Bug report #740267,
regarding virtualbox-guest-dkms: Module not build on kernel: 3.12-0.bpo.1-amd64 
(x86_64)
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
740267: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=740267
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: virtualbox-guest-dkms
Version: 4.2.16-dfsg-3~bpo70+1
Severity: important

Dear Maintainer,
mdt@debian:~$ apt-get install virtualbox-guest-dkms

Loading new virtualbox-guest-4.2.16 DKMS files...
First Installation: checking all kernels...
Building only for 3.12-0.bpo.1-amd64
Building initial module for 3.12-0.bpo.1-amd64
Error! Bad return status for module build on kernel: 3.12-0.bpo.1-amd64 (x86_64)
Consult /var/lib/dkms/virtualbox-guest/4.2.16/build/make.log for more 
information.

DKMS make.log for virtualbox-guest-4.2.16 for kernel 3.12-0.bpo.1-amd64 (x86_64)
gio 27 feb 2014, 16.34.10, CET
make: Entering directory `/usr/src/linux-headers-3.12-0.bpo.1-amd64'
  LD  /var/lib/dkms/virtualbox-guest/4.2.16/build/built-in.o
  LD  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/built-in.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest-linux.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.o
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c: In function 
‘VBoxGuestCommonGetHandledEventsLocked’:
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c:87:5: 
warning: ISO C90 forbids mixed declarations and code 
[-Wdeclaration-after-statement]
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c: In function 
‘VBoxGuestCommonCheckEvents’:
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c:2510:5: 
warning: ISO C90 forbids mixed declarations and code 
[-Wdeclaration-after-statement]
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c:2528:13: 
warning: ISO C90 forbids mixed declarations and code 
[-Wdeclaration-after-statement]
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c: In function 
‘VBoxGuestCommonGuestCapsAcquire’:
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c:2577:5: 
warning: ISO C90 forbids mixed declarations and code 
[-Wdeclaration-after-statement]
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c:2622:5: 
warning: ISO C90 forbids mixed declarations and code 
[-Wdeclaration-after-statement]
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c:2635:5: 
warning: ISO C90 forbids mixed declarations and code 
[-Wdeclaration-after-statement]
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c: In function 
‘VBoxGuestCommonIOCtl’:
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest.c:2788:9: 
warning: ISO C90 forbids mixed declarations and code 
[-Wdeclaration-after-statement]
  CC [M]  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VBoxGuest2.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/GenericRequest.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/HGCMInternal.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/Init.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/PhysHeap.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/SysHlp.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/VMMDev.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/alloc-r0drv.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/initterm-r0drv.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/memobj-r0drv.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/mpnotification-r0drv.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/powernotification-r0drv.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/linux/alloc-r0drv-linux.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/linux/assert-r0drv-linux.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/linux/initterm-r0drv-linux.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/linux/memobj-r0drv-linux.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/linux/memuserkernel-r0drv-linux.o
  CC [M]  
/var/lib/dkms/virtualbox-guest/4.2.16/build/vboxguest/r0drv/linu

Bug#680742: marked as done (Request: Reactivation of RoarAudio support in openal-soft)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 07:20:22 +
with message-id 
and subject line Bug#680742: fixed in openal-soft 1:1.17.2-2
has caused the Debian Bug report #680742,
regarding Request: Reactivation of RoarAudio support in openal-soft
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
680742: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=680742
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---

Package: openal-soft
Version: 1:1.14-4

Sadly i had to see that RoarAudio support got disabled in openal-soft in 
debian...


This is a feature i use and it works well upstream.

I hereby request the reactivation of this Feature.

Thanks.

Regards,
Stephan


--- End Message ---
--- Begin Message ---
Source: openal-soft
Source-Version: 1:1.17.2-2

We believe that the bug you reported is fixed in the latest version of
openal-soft, which is due to be installed in the Debian FTP archive.

A summary of the changes between this version and the previous one is
attached.

Thank you for reporting the bug, which will now be closed.  If you
have further comments please address them to 680...@bugs.debian.org,
and the maintainer will reopen the bug report if appropriate.

Debian distribution maintenance software
pp.
Helmut Grohne  (supplier of updated openal-soft package)

(This message was generated automatically at their request; if you
believe that there is a problem with it please contact the archive
administrators by mailing ftpmas...@ftp-master.debian.org)


-BEGIN PGP SIGNED MESSAGE-
Hash: SHA512

Format: 1.8
Date: Sun, 04 Sep 2016 07:59:01 +0200
Source: openal-soft
Binary: libopenal-dev libopenal1 libopenal1-dbg openal-info makehrtf 
libopenal-data
Architecture: source all amd64
Version: 1:1.17.2-2
Distribution: unstable
Urgency: medium
Maintainer: Debian Games Team 
Changed-By: Helmut Grohne 
Description:
 libopenal-data - Software implementation of the OpenAL audio API (data files)
 libopenal-dev - Software implementation of the OpenAL audio API (development 
file
 libopenal1 - Software implementation of the OpenAL audio API (shared library)
 libopenal1-dbg - Software implementation of the OpenAL audio API (debug 
symbols)
 makehrtf   - HRTF Processing and Composition Utility
 openal-info - Informational utility for the OpenAL audio API
Closes: 680742 808184 836600
Changes:
 openal-soft (1:1.17.2-2) unstable; urgency=medium
 .
   [ Bret Curtis ]
   * add support back to sndio (Closes: #808184, #680742)
 .
   [ Helmut Grohne ]
   * Fix FTCBFS: (Closes: #836600)
 + Invoke cmake via dh_auto_configure
 + Pass --builddirectory to dh
 + Invoke triplet-prefixed CC from d/rules
Checksums-Sha1:
 1114ead633a25a6d913313c648a35afa4554a84f 2569 openal-soft_1.17.2-2.dsc
 284ee280a5a1323a194bc6c77554e02eca4435e3 12264 
openal-soft_1.17.2-2.debian.tar.xz
 c937f8e2bd8193398bd1f9a617b381079b3fc661 106674 libopenal-data_1.17.2-2_all.deb
 cf10f95f0da02d2af3aa0f40c4822e490b419a26 27742 libopenal-dev_1.17.2-2_amd64.deb
 a3ea31794872b9e2f2470e695e197efe73e036b1 576540 
libopenal1-dbg_1.17.2-2_amd64.deb
 019a57d171788a19168b7fe124514bfe232cfdee 211910 libopenal1_1.17.2-2_amd64.deb
 125bbde7ae242ac352715aa45fd054bfa76bf180 38064 
makehrtf-dbgsym_1.17.2-2_amd64.deb
 f001f5a461722be360153812cd23a23c9e7dd056 27978 makehrtf_1.17.2-2_amd64.deb
 3c6e311fe0f096a13d574d8109a62a406883e32b 9656 
openal-info-dbgsym_1.17.2-2_amd64.deb
 7d0f0cdacc19e5a138167c33c3375a5ee619b85b 15434 openal-info_1.17.2-2_amd64.deb
Checksums-Sha256:
 7ff20d16a9d3493ea09376e487e85507dd520342434c0de7cc0b324e64bfb0d4 2569 
openal-soft_1.17.2-2.dsc
 5313bd0ec75e148ef21a1cacf262769621e8c9cce5d708db7ec370b8379110a8 12264 
openal-soft_1.17.2-2.debian.tar.xz
 a5538f5a55d1c78a559e3419560e559372f0567764fd83ce985e149f3cca536c 106674 
libopenal-data_1.17.2-2_all.deb
 a1ac89a0f76e439901566fa9e4b2d05ba5c7be8c5eef8aa53364d381ce7415c4 27742 
libopenal-dev_1.17.2-2_amd64.deb
 e2e81e2457ebe7df11461e6dcd063804803fa491cc00a6f20122a577aeaff98a 576540 
libopenal1-dbg_1.17.2-2_amd64.deb
 4d9f5b8e4e4b7f3425f6ac8519594bb642c722c1fd85da7ae33464d276c50aa1 211910 
libopenal1_1.17.2-2_amd64.deb
 3efc1731dc4004c433667854b728417c534af2b65b3b9233e50f4b4fc931aa1d 38064 
makehrtf-dbgsym_1.17.2-2_amd64.deb
 40073b2e110ccd71ce5312afa8af8e9264befe00f81cdfe35b1d1cee86f6b45b 27978 
makehrtf_1.17.2-2_amd64.deb
 bb724510be30ca2820a3cd5b3a5b8fb90be4344b6c811eabe90e60dc0f4d38dd 9656 
openal-info-dbgsym_1.17.2-2_amd64.deb
 d77855cde4fb732c68f62ff243cbb03a932dc53e07c9fef3db4039b0cf493d66 15434 
openal-info_1.17.2-2_amd64.deb
Files:
 fa6e1164ed2db27314a83e1b4a0df3c5 2569 libs o

Bug#770833: marked as done (virtualbox-dkms: Error "Kernel driver not installed (rc=-1908)" after "aptitude upgrade")

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:18:49 +0200
with message-id 
and subject line Re: Bug#770833: virtualbox-dkms: Error "Kernel driver not 
installed (rc=-1908)" after "aptitude upgrade"
has caused the Debian Bug report #770833,
regarding virtualbox-dkms: Error "Kernel driver not installed (rc=-1908)" after 
"aptitude upgrade"
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
770833: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=770833
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: virtualbox-dkms
Version: 4.3.18-dfsg-1
Severity: important

Dear Maintainer,

After system upgrade (aptitude upgrade) and system reboot, when i try to start
a VM in Virtualbox, a error "Kernel driver not installed (rc=-1908)... Please
reinstall the kernel module by executing /etc/init.d/vboxdrv setup as root" is
showed.

/etc/init.d/vboxdrv doesn't exist.

To solve the problem, i reinstalled the package virtualbox-dkms and load
manually the modules:

aptitude reinstall virtualbox-dkms
modprobe vboxnetadp
modprobe vboxnetflt
modprobe vboxpci

After, VM's is started normally!



-- System Information:
Debian Release: jessie/sid
  APT prefers testing-updates
  APT policy: (500, 'testing-updates'), (500, 'testing')
Architecture: amd64 (x86_64)
Foreign Architectures: i386

Kernel: Linux 3.16.0-4-amd64 (SMP w/4 CPU cores)
Locale: LANG=pt_BR.UTF-8, LC_CTYPE=pt_BR.UTF-8 (charmap=UTF-8)
Shell: /bin/sh linked to /bin/dash

Versions of packages virtualbox-dkms depends on:
ii  dkms2.2.0.3-2
ii  dpkg1.17.21
ii  virtualbox  4.3.18-dfsg-1

virtualbox-dkms recommends no packages.

virtualbox-dkms suggests no packages.

-- no debconf information
--- End Message ---
--- Begin Message ---
Hi, this might have been a dkms issue or something else

dpkg-reconfigure virtualbox-dkms usually works

cheers

G.



signature.asc
Description: OpenPGP digital signature
--- End Message ---


Bug#704130: marked as done (virtualbox-guest-dkms: Module build fails on kernel 3.2 - please apply upstream patch)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:20:35 +0200
with message-id <5922daee-2d62-b1e4-f9c5-e5f8dd61a...@debian.org>
and subject line Re: virtualbox-guest-dkms: Module build fails on kernel 3.2 - 
please apply upstream patch
has caused the Debian Bug report #704130,
regarding virtualbox-guest-dkms: Module build fails on kernel 3.2 - please 
apply upstream patch
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
704130: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=704130
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---
Package: virtualbox-guest-dkms
Version: 4.0.10-dfsg-1~bpo60+1
Severity: important


MIME-Version: 1.0
Content-Transfer-Encoding: 8bit
Content-Type: text/plain; charset="UTF-8"
From: Andrew Gallagher 
To: Debian Bug Tracking System 
Subject: virtualbox-guest-dkms: module build fails on kernel 3.2 - please 
implement
 upstream patch
Message-ID: <20130328110730.6268.72127.reportbug@itchy>
X-Mailer: reportbug 4.12.6
Date: Thu, 28 Mar 2013 11:07:30 +

Package: virtualbox-guest-dkms
Version: 4.0.10-dfsg-1~bpo60+1
Severity: important


There is an error building utils.o under kernel 3.2 - this has been fixed 
upstream
for some time and a patch is available:

https://www.virtualbox.org/changeset/39224/vbox


Transcript:

agallagher@itchy:~$ sudo apt-get install --reinstall virtualbox-guest-dkms
Reading package lists... Done
Building dependency tree   
Reading state information... Done
The following packages were automatically installed and are no longer required:
  libbase-java-openoffice.org libxerces2-java fonts-opensymbol mesa-common-dev 
libxerces2-java-gcj
  libserializer-java-openoffice.org libjaxp1.3-java-gcj
Use 'apt-get autoremove' to remove them.
0 upgraded, 0 newly installed, 1 reinstalled, 0 to remove and 0 not upgraded.
Need to get 0 B/547 kB of archives.
After this operation, 0 B of additional disk space will be used.
(Reading database ... 142544 files and directories currently installed.)
Preparing to replace virtualbox-guest-dkms 4.0.10-dfsg-1~bpo60+1 (using 
.../virtualbox-guest-dkms_4.0.10-dfsg-1~bpo60+1_all.deb) ...

--
Deleting module version: 4.0.10
completely from the DKMS tree.
--
Done.
Unpacking replacement virtualbox-guest-dkms ...
Setting up virtualbox-guest-dkms (4.0.10-dfsg-1~bpo60+1) ...
Loading new virtualbox-guest-4.0.10 DKMS files...
Building only for 3.2.0-0.bpo.4-rt-amd64
Building initial module for 3.2.0-0.bpo.4-rt-amd64

Error! Bad return status for module build on kernel: 3.2.0-0.bpo.4-rt-amd64 
(x86_64)
Consult the make.log in the build directory
/var/lib/dkms/virtualbox-guest/4.0.10/build/ for more information.
agallagher@itchy:~$ tail -20 
/var/lib/dkms/virtualbox-guest/4.0.10/build/make.log
  LD [M]  /var/lib/dkms/virtualbox-guest/4.0.10/build/vboxguest/vboxguest.o
  LD  /var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/built-in.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/vfsmod.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/dirops.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/lnkops.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/regops.o
  CC [M]  /var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/utils.o
/var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/utils.c: In function 
‘sf_init_inode’:
/var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/utils.c:112: error: 
assignment of read-only member ‘i_nlink’
/var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/utils.c:121: error: 
assignment of read-only member ‘i_nlink’
/var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/utils.c:131: error: 
assignment of read-only member ‘i_nlink’
/var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/utils.c: In function 
‘sf_nlscpy’:
/var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/utils.c:562: warning: 
passing argument 3 of ‘utf8_to_utf32’ from incompatible pointer type
/usr/src/linux-headers-3.2.0-0.bpo.4-common-rt/include/linux/nls.h:53: note: 
expected ‘unicode_t *’ but argument is of type ‘wchar_t *’
make[4]: *** [/var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf/utils.o] Error 
1
make[3]: *** [/var/lib/dkms/virtualbox-guest/4.0.10/build/vboxsf] Error 2
make[2]: *** [_module_/var/lib/dkms/virtualbox-guest/4.0.10/build] Error 2
make[1]: *** [sub-make] Error 2
make: *** [all] Error 2
make: Leaving directory `/usr/src/linux-headers-3.2.0-0.bpo.4-rt-amd64'


-- System Information:
Debian Release: 6.0.7
  APT prefers stable
  APT policy: (500, 'stable')
Architecture: amd64 (x86_64)

Kernel: Linux 3.2.0-0.bpo.4-rt-amd64 (SMP

Bug#794066: marked as done (dblatex: Way to control DPI of converted figures?)

2016-09-14 Thread Debian Bug Tracking System
Your message dated Wed, 14 Sep 2016 09:13:42 +0200
with message-id <5997.1473837222@manetheren>
and subject line dblatex BTS #794066 is resolved in dblatex 0.3.8
has caused the Debian Bug report #794066,
regarding dblatex: Way to control DPI of converted figures?
to be marked as done.

This means that you claim that the problem has been dealt with.
If this is not the case it is now your responsibility to reopen the
Bug report if necessary, and/or fix the problem forthwith.

(NB: If you are a system administrator and have no idea what this
message is talking about, this may indicate a serious mail system
misconfiguration somewhere. Please contact ow...@bugs.debian.org
immediately.)


-- 
794066: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=794066
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems
--- Begin Message ---

Package: dblatex
Version: 0.3.5-2

When trying to publish a PDF generated using dblatex on lulu.com, I was
told:

  We detected low resolution images in your file (pages 215, 221, 223,
  233, 262, 278). For best results we recommend image resolution of 300
  ppi.

According to the dblatex output, my SVG files were converted to PNG
using this command:

  inkscape -z -D --export-png=fig8.png  "/tmp/project/1551.svg"

The output  look like this, telling me the DPI is 90:

  inkscape -z -D --export-png=fig8.png "/tmp/project/1551.svg"
  Background RRGGBBAA: ff00
  Area 1.17345e-08:-2.25455e-07:333.96:333.348 exported to 334 x 333
pixels (90 dpi)
  Bitmap saved as: fig8.png

The inkscape manual page claim that the --export-dpi=DPI option can be
used to control the DPI.  For printing, the DPI should be 300.  Is there
some way to adjust how dblatex convert SVGs?

Perhaps it is possible to convert SVGs to a vector format that
latex/xetex understand, instead of using a pixel format?

-- 
Happy hacking
Petter Reinholdtsen
--- End Message ---
--- Begin Message ---
Hi Petter,

with dblatex 0.3.8 and the new XML based configuration format you can
control the image resolution, compare
  file:///usr/share/doc/dblatex-doc/xhtml/manual/sec-specs.html
respectively
  http://dblatex.sourceforge.net/doc/manual/sec-specs.html

Hope this helps and thus closing this report, feel free to reopen if
there are remaining issues.

Regards, Andreas
-- 
Andreas Hoenen 
GPG: 1024D/B888D2CE
 A4A6 E8B5 593A E89B 496B
 82F0 728D 8B7E B888 D2CE


signature.asc
Description: PGP signature
--- End Message ---


Processed: closing 836585

2016-09-14 Thread Debian Bug Tracking System
Processing commands for cont...@bugs.debian.org:

> close 836585
Bug #836585 [src:celery] celery: FTBFS in testing (failing tests)
Marked Bug as done
> thanks
Stopping processing here.

Please contact me if you need assistance.
-- 
836585: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=836585
Debian Bug Tracking System
Contact ow...@bugs.debian.org with problems