[jira] [Created] (AIRAVATA-2993) Hold the execution of Helix components when that API Server is not responding

[Dimuthu Upeksha (JIRA)]

Dimuthu Upeksha created AIRAVATA-2993:
-

 Summary: Hold the execution of Helix components when that API 
Server is not responding
 Key: AIRAVATA-2993
 URL: https://issues.apache.org/jira/browse/AIRAVATA-2993
 Project: Airavata
  Issue Type: Improvement
  Components: helix implementation
Affects Versions: 0.17
Reporter: Dimuthu Upeksha
Assignee: Dimuthu Upeksha


When the API server is down or unreachable by helix components, there is no use 
of Helix components to be running tasks as they will eventually fail. So we 
need to pause helix controller, helix participant, post workflow manager, pre 
workflow manager and monitors once they detected the API server is not 
responding.



--
This message was sent by Atlassian JIRA
(v7.6.3#76005)

[jira] [Created] (AIRAVATA-2994) Experiment input editors: transformations

[Marcus Christie (JIRA)]

Marcus Christie created AIRAVATA-2994:
-

 Summary: Experiment input editors: transformations
 Key: AIRAVATA-2994
 URL: https://issues.apache.org/jira/browse/AIRAVATA-2994
 Project: Airavata
  Issue Type: Sub-task
  Components: Django Portal
Reporter: Marcus Christie
Assignee: Marcus Christie


Add the ability to add transformations to input editors through input metadata, 
validations (AIRAVATA-2762) and dependencies (AIRAVATA-2761).

 The schema I'm thinking of is
{code}
{
  "editor": {
"transformations": [
  {
"type": "regex-replace",
"value": ["\s+", "", ""]
  },
  ...
]
  }
}
{code}

A list of transformations can be specified. They will be applied in order to 
the input value whenever it changes.

The type must be implemented by a Transformation class ([something like how the 
ValidatorFactory 
works|https://github.com/apache/airavata-django-portal/blob/master/django_airavata/apps/api/static/django_airavata_api/js/models/validators/ValidatorFactory.js#L10]).

Example: transform
{noformat}
>101M:A|PDBID|CHAIN|SEQUENCE
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK
GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
{noformat}

into
{noformat}
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
{noformat}

That is, remove the initial header line and remove all newlines.


Other notes:
* transformations should be applied before validations
* need to add a {{transform(value)}} method to InputDataObjectType. transform() 
should apply transformations and return the transformed value. If there are no 
transformations then transform() should just return the given value




--
This message was sent by Atlassian JIRA
(v7.6.3#76005)