problems with libwww-perl module

[Pedro A Reche Gallardo]

Hi all,  one more time I need some help. In the past I have used the
libwww-perl module  to execute and get the information from that remote
web server. This was actually quite simple because I did not have to
post any data. Now I wrote an script that it will have to post some data
to the server and then retrieve the information. However, I am a little
bit lost because the server in question
(http://www.cbs.dtu.dk/services/TMHMM/) runs the job in the background,
and then it  sends you to a result page latter, and I do not know how to
get there.   The site I am working with is at the url
http://www.cbs.dtu.dk/services/TMHMM/, and here is my script:

#!/usr/sbin/perl -w
use strict;
require HTTP::Message;
use HTTP::Request::Common;
use LWP::UserAgent;
my $ua = LWP::UserAgent->new;
my $FILE = shift @ARGV;


my $res =$ua->request(POST 'http://www.cbs.dtu.dk/cgi-bin/nph-webface',
        Content_Type => 'form-data',
        Content      => [configfile
=>'/home/genome2/www/Public_html/services/TMHMM-2.0/TMHMM2.cf',
        outform   => '-short',
        seqfile   => ["$FILE"]],);


my $req =$ua->request(GET
'http://www.cbs.dtu.dk/cgi-bin/nph-webface?jobid=TMHMM2,$res&opt=none');#

my @lines = split(/\n/, $ua->request($req)->as_string);
my $count = @lines;


for (my $y = 0; $y < $count; $y++) {
        if  ($lines[$y] =~ /^Sequence/) {
                print $lines[$y],"\n";

        }
}
########


I am running the script as it follows:
%script.pl file; where  file is:
>gi|75188|pir||QQIVE1 hypothetical 18K protein - influenza A virus
(strain A/PR/8/ 34)
MLFAQNYSLLSSVCVSLLQSTILFLQTSDLIVPAISRFCFGVSGGLPFSLLLLQANLCRVSETRTVLSFH
SSPPMRTPTAFLTSSAVCPGREGNGEISPTIAPSSVKALSNIRVSSRSKITLKFAFSMMFLSMIAWSILI
QRGPATFCLGMSMDQSLDISSRVMSVR*

When I run the script I got the following message:
You need a request object, not a HTTP::Response object at ./ranseq.pl
line 19

As I said  I am a little bit lost, and I will be very happy for any help
on the subject.


Cheers
*******************************************************************
PEDRO A. RECHE , pHD            TL: 617 632 3824
Dana-Farber Cancer Institute,   FX: 617 632 4569
Harvard Medical School,         EM: [EMAIL PROTECTED]
44 Binney Street, D1510A,       EM: [EMAIL PROTECTED]
Boston, MA 02115                URL:
http://www.reche.org
*******************************************************************