Hi All, I have a file (see below) that I would like to split in three files: One file for the information under "Alignment (DIALIGN format)", another for the information under the line "Alignment (FASTA format)" and a third one for the information under sequence tree. Any help to do this will be appreciated. Cheers Alignment (DIALIGN format): =========================== gi|38145|e 1 MALPVTALLL PLALLLHAAR ---PSQFRVS PLDRTWNLGE TVELKCQVLL gi|7438693 1 MALPVTALLL PLALLLHAAR ---PSQFRVS PLDRTWNLGE TVELKCQVLL ********** ********** ******* ********** ********** ********** ********* ******* ********** ********** Alignment (FASTA format): ========================= >gi|38145|emb|CAA4278 MALPVTALLLPLALLLHAAR---PSQFRVSPLDRTWNLGETVELKCQVLL SNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDT >gi|7438693|pir||S256 MALPVTALLLPLALLLHAAR---PSQFRVSPLDRTWNLGETVELKCQVLL Sequence tree: ============== ((gi|38145|emb|CAA4278:0.003018, gi|7438693|pir||S256:0.003018):0.002338, gi|1168854|sp|P41688:0.005357); *************************************************************************** PEDRO a. RECHE gallardo, pHD TL: 617 632 3824 Scientist, Mol.Immnunol.Foundation, FX: 617 632 3351 Dana-Farber Cancer Institute, EM: [EMAIL PROTECTED] Harvard Medical School, EM: [EMAIL PROTECTED] 44 Binney Street, D610C, URL: http://www.reche.org Boston, MA 02115 ***************************************************************************