[frameworks-kglobalaccel] [Bug 488772] User .desktop not work when using keyboard shortcuts

https://bugs.kde.org/show_bug.cgi?id=488772 --- Comment #3 from Ronald --- I'm not going to change the global locale settings as a workaround. Not a blocking problem, waiting for the fixing. -- You are receiving this mail because: You are watching all bug changes.

[kde] [Bug 490002] Duplicated candidates when searching in Qt Assistant

https://bugs.kde.org/show_bug.cgi?id=490002 --- Comment #4 from Ronald --- OK, https://bugreports.qt.io -- You are receiving this mail because: You are watching all bug changes.

[kde] [Bug 490002] Duplicated candidates when searching in Qt Assistant

https://bugs.kde.org/show_bug.cgi?id=490002 --- Comment #3 from Ronald --- (In reply to Antonio Rojas from comment #2) > Qt Assistant is not a KDE project Where should I file the bug? -- You are receiving this mail because: You are watching all bug changes.

[frameworks-kglobalaccel] [Bug 488772] User .desktop not work when using keyboard shortcuts

https://bugs.kde.org/show_bug.cgi?id=488772 Ronald changed: What|Removed |Added CC||follow...@163.com -- You are receiving this mail

[kde] [Bug 490002] Duplicated candidates when searching in Qt Assistant

https://bugs.kde.org/show_bug.cgi?id=490002 Ronald changed: What|Removed |Added CC||follow...@163.com -- You are receiving this mail

[kde] [Bug 490002] Duplicated candidates when searching in Qt Assistant

https://bugs.kde.org/show_bug.cgi?id=490002 --- Comment #1 from Ronald --- Created attachment 171519 --> https://bugs.kde.org/attachment.cgi?id=171519=edit Auto Detected Documentation The auto dectected documentation for the sample, at Edit / Preferences / Help / Documentation, filte

[kde] [Bug 490002] New: Duplicated candidates when searching in Qt Assistant

https://bugs.kde.org/show_bug.cgi?id=490002 Bug ID: 490002 Summary: Duplicated candidates when searching in Qt Assistant Classification: I don't know Product: kde Version: unspecified Platform: Other OS: Linux

[kde] [Bug 488772] New: User .desktop not work when using keyboard shortcuts

https://bugs.kde.org/show_bug.cgi?id=488772 Bug ID: 488772 Summary: User .desktop not work when using keyboard shortcuts Classification: I don't know Product: kde Version: unspecified Platform: Arch Linux OS: Linux

[okular] [Bug 486186] The visibility of the sidebar and the corresponding UI items not consistent

https://bugs.kde.org/show_bug.cgi?id=486186 Ronald changed: What|Removed |Added Summary|The visibility of the |The visibility of the |sidebar

[okular] [Bug 486186] New: The visibility of the sidebar and the corresponding UI items should consistent.

https://bugs.kde.org/show_bug.cgi?id=486186 Bug ID: 486186 Summary: The visibility of the sidebar and the corresponding UI items should consistent. Classification: Applications Product: okular Version: 24.02.2

[dolphin] [Bug 482680] New: Shift+F4 in Dolphin not work in Plasma 6

https://bugs.kde.org/show_bug.cgi?id=482680 Bug ID: 482680 Summary: Shift+F4 in Dolphin not work in Plasma 6 Classification: Applications Product: dolphin Version: 24.02.0 Platform: Arch Linux OS: Linux Status:

[kde] [Bug 479725] Under Wayland task manager is not using the same path as Konsole

https://bugs.kde.org/show_bug.cgi?id=479725 --- Comment #9 from Ronald Hudson --- I am not sure at this point. I am pretty sure that if I did it was only to try to add /usr/games in.  In fact when I run Konsole and type kpat it started right up. On 1/19/24 08:50, Nicolas Fella wrote: > a

[kde] [Bug 479725] Under Wayland task manager is not using the same path as Konsole

https://bugs.kde.org/show_bug.cgi?id=479725 --- Comment #7 from Ronald Hudson --- Here you go: rhudson@adam:~$ ps -e | grep plasma 115971 tty2 00:00:00 startplasma-way 116334 ?    00:00:31 plasmashell 122328 ?    00:00:00 plasma-browser- rhudson@adam:~$ cat /proc/116334/environ HOME

[kde] [Bug 479725] Under Wayland task manager is not using the same path as Konsole

https://bugs.kde.org/show_bug.cgi?id=479725 --- Comment #5 from Ronald Hudson --- That copy seems to have worked. at least for kpat. -- You are receiving this mail because: You are watching all bug changes.

[kde] [Bug 479725] Under Wayland task manager is not using the same path as Konsole

https://bugs.kde.org/show_bug.cgi?id=479725 --- Comment #4 from Ronald Hudson --- I will copy kpat to /usr/bin and go back to Wayland to see if that makes a difference. -- You are receiving this mail because: You are watching all bug changes.

[kde] [Bug 479725] Under Wayland task manager is not using the same path as Konsole

https://bugs.kde.org/show_bug.cgi?id=479725 --- Comment #3 from Ronald Hudson --- Nicolas, Thanks for looking into this for me. rhudson@adam:~$ cd /usr/games rhudson@adam:/usr/games$ ls fortunegweledklicketykpatkshisenmicropolisonekotint rhudson@adam:/usr/games$ file kpat kpat: ELF 64-bit LSB

[kde] [Bug 479725] Under Wayland task manager is not using the same path as Konsole

https://bugs.kde.org/show_bug.cgi?id=479725 Ronald Hudson changed: What|Removed |Added CC||hudson...@live.com -- You are receiving

[kde] [Bug 479725] Under Wayland task manager is not using the same path as Konsole

https://bugs.kde.org/show_bug.cgi?id=479725 --- Comment #1 from Ronald Hudson --- I would rather run Wayland as it seems to be the clear leader with X11 on its way to being deprecated. -- You are receiving this mail because: You are watching all bug changes.

[kde] [Bug 479725] New: Under Wayland task manager is not using the same path as Konsole

https://bugs.kde.org/show_bug.cgi?id=479725 Bug ID: 479725 Summary: Under Wayland task manager is not using the same path as Konsole Classification: I don't know Product: kde Version: unspecified Platform: Debian

[plasmashell] [Bug 476909] Allow slideshow wallpapers to be previewed in the same way as static image wallpapers can be previewed

https://bugs.kde.org/show_bug.cgi?id=476909 --- Comment #9 from Ronald Hudson --- (In reply to Ronald Hudson from comment #8) > From History: > Summary Was: Feature Request: Add option for previewing wallpaper > Changed > to: Allow slideshow wallpapers to be previewed

[plasmashell] [Bug 476909] Allow slideshow wallpapers to be previewed in the same way as static image wallpapers can be previewed

https://bugs.kde.org/show_bug.cgi?id=476909 --- Comment #8 from Ronald Hudson --- >From History: Summary Was: Feature Request: Add option for previewing wallpaper Changed to: Allow slideshow wallpapers to be previewed in the same way as static image wallpapers can be previe

[systemsettings] [Bug 476909] Feature Request: Please make the next random wallpaper= the newest file placed in wallpaper folder

https://bugs.kde.org/show_bug.cgi?id=476909 --- Comment #7 from Ronald Hudson --- Or perhaps... In the Slideshow UI there is a button that says "Audition an image" - this would bring up a standard file dialog to pick an image file. The image file would be 'modified' in all the

[systemsettings] [Bug 476909] Feature Request: Please make the next random wallpaper= the newest file placed in wallpaper folder

https://bugs.kde.org/show_bug.cgi?id=476909 --- Comment #6 from Ronald Hudson --- (In reply to fanzhuyifan from comment #5) > How do you feel about changing this feature request to adding some UI to > preview wallpapers or just temporarily using a wallpaper on click/selection? > T

[systemsettings] [Bug 476909] Feature Request: Please make the next random wallpaper= the newest file placed in wallpaper folder

https://bugs.kde.org/show_bug.cgi?id=476909 --- Comment #3 from Ronald Hudson --- I would like to suggest a potential solution for this feature by incorporating a button within the Slideshow GUI. This button could facilitate the copying of a selected picture into one of the designated

[systemsettings] [Bug 476909] Feature Request: Please make the next random wallpaper= the newest file placed in wallpaper folder

https://bugs.kde.org/show_bug.cgi?id=476909 Ronald Hudson changed: What|Removed |Added Ever confirmed|0 |1 Resolution|INTENTIONAL

[systemsettings] [Bug 476909] Feature Request: Please make the next random wallpaper= the newest file placed in wallpaper folder

https://bugs.kde.org/show_bug.cgi?id=476909 Ronald Hudson changed: What|Removed |Added Platform|Other |Debian stable CC

[systemsettings] [Bug 476909] New: Feature Request: Please make the next random wallpaper= the newest file placed in wallpaper folder

https://bugs.kde.org/show_bug.cgi?id=476909 Bug ID: 476909 Summary: Feature Request: Please make the next random wallpaper= the newest file placed in wallpaper folder Classification: Applications Product: systemsettings Version:

[okular] [Bug 469171] New: ChatGPT

https://bugs.kde.org/show_bug.cgi?id=469171 Bug ID: 469171 Summary: ChatGPT Classification: Applications Product: okular Version: unspecified Platform: Other OS: Linux Status: REPORTED Severity:

[digikam] [Bug 468781] New: Digikam crashes on album creation

https://bugs.kde.org/show_bug.cgi?id=468781 Bug ID: 468781 Summary: Digikam crashes on album creation Classification: Applications Product: digikam Version: unspecified Platform: Kubuntu OS: Linux Status:

[kdenlive] [Bug 459017] subtitles fail to save/export

https://bugs.kde.org/show_bug.cgi?id=459017 --- Comment #2 from Ronald Visschers --- Dear Eric, I used the regular Ubuntu software app available from the favorites bar. I don’t know which installation method the ubuntu software center actually uses, but i guess APT. Its version is 3.38.1. I

[kdenlive] [Bug 459017] New: subtitles fail to save/export

https://bugs.kde.org/show_bug.cgi?id=459017 Bug ID: 459017 Summary: subtitles fail to save/export Product: kdenlive Version: 22.08.0 Platform: Ubuntu Packages OS: Linux Status: REPORTED Severity: normal

[konqueror] [Bug 457741] New: Konquer browser crashed on opening a URL in the konsole

the URL to the report in the console. CTRL clicked on the URL, and that led to the crash. Output in console: * What went wrong: Execution failed for task ':provider:junit5spring:test'. > There were failing tests. See the report at: > file:///home/ronald/Development/Projects/Pact/pact-jvm/pr

[kdenlive] [Bug 455867] New: In title editor ALT+D starts but crashes right away

https://bugs.kde.org/show_bug.cgi?id=455867 Bug ID: 455867 Summary: In title editor ALT+D starts but crashes right away Product: kdenlive Version: unspecified Platform: unspecified OS: Microsoft Windows Status:

[dolphin] [Bug 455212] New: Need sorting files by Chinese Pinyin

https://bugs.kde.org/show_bug.cgi?id=455212 Bug ID: 455212 Summary: Need sorting files by Chinese Pinyin Product: dolphin Version: unspecified Platform: Manjaro OS: Linux Status: REPORTED Severity: normal

[krita] [Bug 452639] New: Preferencias > Estilos > Android

https://bugs.kde.org/show_bug.cgi?id=452639 Bug ID: 452639 Summary: Preferencias > Estilos > Android Product: krita Version: 5.0.2 Platform: Android OS: Unspecified Status: REPORTED Severity: normal

[kcontrol] [Bug 26146] (no debugging symbols found)...(no debugging symbols found)... (no debugging symbols found)...(no debugging symbols found)... (no debugging symbols found)...(no debugging symbol

https://bugs.kde.org/show_bug.cgi?id=26146 ronald.mess...@web.de changed: What|Removed |Added CC||ronald.mess...@web.de -- You are

[elisa] [Bug 432465] Se cierra automaticamete

https://bugs.kde.org/show_bug.cgi?id=432465 Ronald changed: What|Removed |Added Platform|Other |PCLinuxOS -- You are receiving this mail because

[elisa] [Bug 432465] New: Se cierra automaticamete

https://bugs.kde.org/show_bug.cgi?id=432465 Bug ID: 432465 Summary: Se cierra automaticamete Product: elisa Version: 20.12.1 Platform: Other OS: Linux Status: REPORTED Severity: normal Priority:

[digikam] [Bug 424051] Please add search for images without captions

https://bugs.kde.org/show_bug.cgi?id=424051 --- Comment #2 from Ronald Orenstein --- The following comment was made to the list in response to my query, by sknahT: * Search tab > advanced search > reset (to make sure we start fresh * At the top right: Options: "None of these conditi

[digikam] [Bug 424051] PPlease add search for images without captions

https://bugs.kde.org/show_bug.cgi?id=424051 Ronald Orenstein changed: What|Removed |Added CC||ron.orenst...@rogers.com -- You

[digikam] [Bug 424051] Please add search for images without captions

https://bugs.kde.org/show_bug.cgi?id=424051 Ronald Orenstein changed: What|Removed |Added Summary|PPlease add search for |Please add search

[digikam] [Bug 424051] New: PPlease add search for images without captions

https://bugs.kde.org/show_bug.cgi?id=424051 Bug ID: 424051 Summary: PPlease add search for images without captions Product: digikam Version: unspecified Platform: macOS Disk Images OS: macOS Status: REPORTED

[kdenlive] [Bug 418049] New: Click and drag moves the whole window

https://bugs.kde.org/show_bug.cgi?id=418049 Bug ID: 418049 Summary: Click and drag moves the whole window Product: kdenlive Version: 19.12.2 Platform: Other OS: MS Windows Status: REPORTED Severity: major

[OCS] [Bug 415060] Provide 160x160 small preview images

https://bugs.kde.org/show_bug.cgi?id=415060 Ronald changed: What|Removed |Added Assignee|lei...@leinir.dk|rv...@email.de CC

[digikam] [Bug 411027] image files *.heic from iphones do not show up in digikam thumbnails although ther are find in MS file browser

https://bugs.kde.org/show_bug.cgi?id=411027 --- Comment #21 from Ronald R. Berliner --- I just noticed that IMDisplay Version 1.0, Version: ImageMagick 7.0.8-52 Q16 x64 2019-07-05 properly displays HEIC files. Maybe this is already known. Ron -- You are receiving this mail because: You

[digikam] [Bug 411027] image files *.heic from iphones do not show up in digikam thumbnails although ther are find in MS file browser

https://bugs.kde.org/show_bug.cgi?id=411027 --- Comment #19 from Ronald R. Berliner --- I have finally been able to install and test digiKam-6.4.0-git-20190918T101756-Win64.exe. I observe (as do several others) that the HEIC files do not appear. The only other tool (besides Win10) that I

[digikam] [Bug 411053] New: digikam-6.2.0-x86-64 appimage fails to run in Ubuntu 16.04

https://bugs.kde.org/show_bug.cgi?id=411053 Bug ID: 411053 Summary: digikam-6.2.0-x86-64 appimage fails to run in Ubuntu 16.04 Product: digikam Version: 6.2.0 Platform: Ubuntu Packages OS: Linux

[digikam] [Bug 411027] New: image files *.heic from iphones do not show up in digikam thumbnails although ther are find in MS file browser

https://bugs.kde.org/show_bug.cgi?id=411027 Bug ID: 411027 Summary: image files *.heic from iphones do not show up in digikam thumbnails although ther are find in MS file browser Product: digikam Version: 6.2.0

[frameworks-knewstuff] [Bug 391111] Rating doesn't work; all GHNS dialogs always display "Unknown Open Collaboration Service API error

https://bugs.kde.org/show_bug.cgi?id=39 Ronald changed: What|Removed |Added CC||rv...@email.de --- Comment #11 from Ronald

[kwin] [Bug 389665] Rotating screen doesn't work on wayland

https://bugs.kde.org/show_bug.cgi?id=389665 --- Comment #25 from Ronald van Haren --- Created attachment 116143 --> https://bugs.kde.org/attachment.cgi?id=116143=edit log of https://phabricator.kde.org/D16630 -- You are receiving this mail because: You are watching all bug changes.

[kwin] [Bug 389665] Rotating screen doesn't work on wayland

https://bugs.kde.org/show_bug.cgi?id=389665 Ronald van Haren changed: What|Removed |Added CC||ron...@archlinux.org --- Comment #24 from

[kdevelop] [Bug 340844] Crash when toggling a breakpoint

https://bugs.kde.org/show_bug.cgi?id=340844 Ronald Ammann changed: What|Removed |Added Status|NEEDSINFO |REPORTED Resolution|WAITINGFORINFO

[kontact] [Bug 393893] New: Cannot disable week numbers in date navigator

https://bugs.kde.org/show_bug.cgi?id=393893 Bug ID: 393893 Summary: Cannot disable week numbers in date navigator Product: kontact Version: unspecified Platform: Kubuntu Packages OS: Linux Status: UNCONFIRMED

[frameworks-kxmlgui] [Bug 356489] Black field

https://bugs.kde.org/show_bug.cgi?id=356489 --- Comment #18 from Ronald Buckman <ron...@yahoo.com> --- I'm now seeing the black game field if qt5ct is used outside of Plasma to set the Appearance --> Style to either Breeze or Oxygen. I am using Applications 17.08.1, Frameworks 5.38.

[frameworks-kxmlgui] [Bug 356489] Black field

https://bugs.kde.org/show_bug.cgi?id=356489 Ronald Buckman <ron...@yahoo.com> changed: What|Removed |Added CC||ron...@yah

[valgrind] [Bug 375839] Temporary storage exhusted , when long sequence of vfmadd231ps instructions to be executed

https://bugs.kde.org/show_bug.cgi?id=375839 --- Comment #10 from Ronald S. Bultje <rsbul...@gmail.com> --- We're still seeing the issue in FFmpeg. This is valgrind r16297 with vex r3344. ==15422== Memcheck, a memory error detector ==15422== Copyright (C) 2002-2015, and GNU GPL'd, by

[valgrind] [Bug 378068] New: valgrind crashes on AVX2 function in FFmpeg

https://bugs.kde.org/show_bug.cgi?id=378068 Bug ID: 378068 Summary: valgrind crashes on AVX2 function in FFmpeg Product: valgrind Version: unspecified Platform: Other OS: Linux Status: UNCONFIRMED

[calligraflow] [Bug 371125] New: [[[[North Carolina]]]] ⎳⎳ <<1@844@414@4868>> ⎳⎳Intuit QUICKBOOKS Point Of Sale SUPPORT NUMMBER Raleigh Charlotte, Raleigh, Greensboro, Winston-Salem, Durham

https://bugs.kde.org/show_bug.cgi?id=371125 Bug ID: 371125 Summary: North Carolina ⎳⎳ <<1@844@414@4868>> ⎳⎳Intuit QUICKBOOKS Point Of Sale SUPPORT NUMMBER Raleigh Charlotte, Raleigh, Greensboro, Winston-Salem, Durham

[calligrachart] [Bug 371123] New: ⫷⫷⫸⫷ Texas 18*44*41*44*86*8 ⫸⫷⫸⫸ <> Intuit QUICKBOOKS Payroll SUPPORT NUMBER Albany New York, Buffalo, Rochester, Yonkers, Syracuse

https://bugs.kde.org/show_bug.cgi?id=371123 Bug ID: 371123 Summary: ⫷⫷⫸⫷ Texas 18*44*41*44*86*8 ⫸⫷⫸⫸ <> Intuit QUICKBOOKS Payroll SUPPORT NUMBER Albany New York, Buffalo, Rochester, Yonkers, Syracuse Product: calligrachart

[calligraauthor] [Bug 371122] New: {{{{New Mexico}}}} {[[1-844-414-4868]]} {}@{}Texas{}@{} Intuit QUICKBOOKS Customer SUPPORT NUMBER Santa Fe Albuquerque, Las Cruces, Rio Rancho, Santa Fe, Roswell

https://bugs.kde.org/show_bug.cgi?id=371122 Bug ID: 371122 Summary: New Mexico {[[1-844-414-4868]]} {}@{}Texas{}@{} Intuit QUICKBOOKS Customer SUPPORT NUMBER Santa Fe Albuquerque, Las Cruces, Rio Rancho,

[calligraactive] [Bug 371119] New: ∐∐∐∐ ⫸ New Jersey⫷1 844 414 4868⫸⫸ Texas ⫸⫸ Intuit QUICKBOOKS Payroll SUPPORT NUMBER Trenton Newark, Jersey City, Paterson, Elizabeth, Edison

https://bugs.kde.org/show_bug.cgi?id=371119 Bug ID: 371119 Summary: ⫸ New Jersey⫷1 844 414 4868⫸⫸ Texas ⫸⫸ Intuit QUICKBOOKS Payroll SUPPORT NUMBER Trenton Newark, Jersey City, Paterson, Elizabeth, Edison Product:

[buildsystem] [Bug 371118] New: ∉∉∉∉∉ New Hampshire ∉∉∉∉∉ <><>[[1=844=414=4868]]<>New York<> Quickbooks Enterprise Support Phone number Concord Manchester, Nashua, Concord, Derry, Rochester

https://bugs.kde.org/show_bug.cgi?id=371118 Bug ID: 371118 Summary: ∉ New Hampshire ∉ <><>[[1=844=414=4868]]<>New York<> Quickbooks Enterprise Support Phone number Concord Manchester, Nashua, Concord, Derry, Rochester

[bugs.kde.org] [Bug 371117] New: BILLORANITANGE ((Nevada)) 1~844*414_4868 ((TExas)) QUICKBOOKS Payroll SUPPORT NUMBER Carson City Las Vegas, Henderson, North Las Vegas, Reno, Sparks

https://bugs.kde.org/show_bug.cgi?id=371117 Bug ID: 371117 Summary: BILLORANITANGE ((Nevada)) 1~844*414_4868 ((TExas)) QUICKBOOKS Payroll SUPPORT NUMBER Carson City Las Vegas, Henderson, North Las Vegas, Reno, Sparks

[Breeze] [Bug 371116] New: BANDUNI@COM TExas ∭18*44-41*44*868∭New York QUICKBOOKS SUPPORT NUMBER Nebraska Lincoln Omaha, Lincoln, Bellevue, Grand Island, Kearney

https://bugs.kde.org/show_bug.cgi?id=371116 Bug ID: 371116 Summary: BANDUNI@COM TExas ∭18*44-41*44*868∭New York QUICKBOOKS SUPPORT NUMBER Nebraska Lincoln Omaha, Lincoln, Bellevue, Grand Island, Kearney Product: Breeze

[bomber] [Bug 371111] New: AbcdefSULTANJI...Texas *1~844*-*41*-*4868* */*New York*/* QUICKBOOKS Enterprise SUPPORT NUMBER Mississippi Jackson, Gulfport, Hattiesburg, Southaven, Biloxi

https://bugs.kde.org/show_bug.cgi?id=37 Bug ID: 37 Summary: AbcdefSULTANJI...Texas *1~844*-*41*-*4868* */*New York*/* QUICKBOOKS Enterprise SUPPORT NUMBER Mississippi Jackson, Gulfport, Hattiesburg, Southaven,

[bovo] [Bug 371113] New: Intuit New yORK {{@{{@{{1-844-414-4868}}@}}@}} %%@ Texas %%@%%@ Quickbooks Payroll Support Phone Number Montana Helena Billings, Missoula, Great Falls, Bozeman

https://bugs.kde.org/show_bug.cgi?id=371113 Bug ID: 371113 Summary: Intuit New yORK {{@{{@{{1-844-414-4868}}@}}@}} %%@ Texas %%@%%@ Quickbooks Payroll Support Phone Number Montana Helena Billings, Missoula, Great Falls,

[bodega] [Bug 371110] New: %%∭ Minnesota ∭%% 1**(844)**(414)**(4868) ∭∭ QUICKBOOKS Payroll SUPPORT Phone NUMBER Saint Paul Minneapolis, Saint Paul, Rochester, Duluth, Bloomington

https://bugs.kde.org/show_bug.cgi?id=371110 Bug ID: 371110 Summary: %%∭ Minnesota ∭%% 1**(844)**(414)**(4868) ∭∭ QUICKBOOKS Payroll SUPPORT Phone NUMBER Saint Paul Minneapolis, Saint Paul, Rochester, Duluth,

[Bluedevil] [Bug 371109] New: ∾∾O∾M∾∾ TExas ∾∾O∾M∾∾ Michigan⫷18*44*41*44*86*8⫸ QUickbooks Intuit Support Phone Number Lansing Detroit, Grand Rapids, Warren, Sterling Heights, Lansing

https://bugs.kde.org/show_bug.cgi?id=371109 Bug ID: 371109 Summary: ∾∾O∾M∾∾ TExas ∾∾O∾M∾∾ Michigan⫷18*44*41*44*86*8⫸ QUickbooks Intuit Support Phone Number Lansing Detroit, Grand Rapids, Warren, Sterling Heights,

[blogilo] [Bug 371108] New: ⋠⋠⋠Massachusetts⋡⋡⋡⋡ 1∶∶844∶∶414∶∶4868 ⋠⋠TExas ⋡⋡ Quickbooks HELP Support Phone Number Boston, Worcester, Springfield, Lowell, Cambridge

https://bugs.kde.org/show_bug.cgi?id=371108 Bug ID: 371108 Summary: ⋠⋠⋠Massachusetts 1∶∶844∶∶414∶∶4868 ⋠⋠TExas ⋡⋡ Quickbooks HELP Support Phone Number Boston, Worcester, Springfield, Lowell, Cambridge Product: blogilo

[blogilo] [Bug 371107] New: ⋠⋠⋠Massachusetts⋡⋡⋡⋡ 1∶∶844∶∶414∶∶4868 ⋠⋠TExas ⋡⋡ Quickbooks HELP Support Phone Number Boston, Worcester, Springfield, Lowell, Cambridge

https://bugs.kde.org/show_bug.cgi?id=371107 Bug ID: 371107 Summary: ⋠⋠⋠Massachusetts 1∶∶844∶∶414∶∶4868 ⋠⋠TExas ⋡⋡ Quickbooks HELP Support Phone Number Boston, Worcester, Springfield, Lowell, Cambridge Product: blogilo

[blinken] [Bug 371106] New: A≉A≉A≉A≉J≉JJ≉J Maryland 1()844()414()4868 <> Quickbooks HELP Support Phone Number Annapolis Baltimore, Frederick, Rockville, Gaithersburg, Bowie

https://bugs.kde.org/show_bug.cgi?id=371106 Bug ID: 371106 Summary: A≉A≉A≉A≉J≉JJ≉J Maryland 1()844()414()4868 <> Quickbooks HELP Support Phone Number Annapolis Baltimore, Frederick, Rockville, Gaithersburg, Bowie Product:

[bindings] [Bug 371104] New: %∺%∺% Maine Augusta%∺% 1∻844∻4144∻868 @∻@ Texas @∻@ Quickbooks HELP Support Phone Number Portland, Lewiston, Bangor, South Portland, Auburn

https://bugs.kde.org/show_bug.cgi?id=371104 Bug ID: 371104 Summary: %∺%∺% Maine Augusta%∺% 1∻844∻4144∻868 @∻@ Texas @∻@ Quickbooks HELP Support Phone Number Portland, Lewiston, Bangor, South Portland, Auburn Product:

[basket] [Bug 371103] New: <<>> @@%@@{{{1*844*414 4868}}}@@%@@ New York @@ Quickbooks Point of Sale Support Number Rouge New Orleans, Baton Rouge, Shreveport, Lafayette, Lake Charles

https://bugs.kde.org/show_bug.cgi?id=371103 Bug ID: 371103 Summary: <<>> @@%@@{{{1*844*414 4868}}}@@%@@ New York @@ Quickbooks Point of Sale Support Number Rouge New Orleans, Baton Rouge, Shreveport, Lafayette, Lake

[bangarang] [Bug 371102] New: Kentucky 1(844)-(414)-(4868) <<<><<<Texas<<<>>> Intuit QB Phone NumberFrankfort Louisville, Lexington, Bowling Green, Owensboro, Covington

https://bugs.kde.org/show_bug.cgi?id=371102 Bug ID: 371102 Summary: Kentucky 1(844)-(414)-(4868) <<<><<>> Intuit QB Phone NumberFrankfort Louisville, Lexington, Bowling Green, Owensboro, Covington Product:

[BalooWidgets] [Bug 371101] New: %%Kansas%% <<<<1(844)?(414)-(4868)>>TExas>> Topeka Intuit QuickBooks Support Number Wichita, Overland Park, Kansas City, Topeka, Olathe

https://bugs.kde.org/show_bug.cgi?id=371101 Bug ID: 371101 Summary: %%Kansas%% 1(844)?(414)-(4868)>>TExas>> Topeka Intuit QuickBooks Support Number Wichita, Overland Park, Kansas City, Topeka, Olathe Product:

[Artikulate] [Bug 371100] New: ⪔⪔nEW yORK⪔⪔⫷1>"844>"414>"4868⨊⪔⫷⫸ ⪔⪔ Texas ⪔⪔ iNTUIT qUICKBOOKS SUPPORT Phone Number Moines, Cedar Rapids, Davenport, Sioux City, Waterloo

https://bugs.kde.org/show_bug.cgi?id=371100 Bug ID: 371100 Summary: ⪔⪔nEW yORK⪔⪔⫷1>"844>"414>"4868⨊⪔⫷⫸ ⪔⪔ Texas ⪔⪔ iNTUIT qUICKBOOKS SUPPORT Phone Number Moines, Cedar Rapids, Davenport, Sioux City, Waterloo Product:

[Artikulate] [Bug 371099] New: ⪔⪔nEW yORK⪔⪔⫷1>"844>"414>"4868⨊⪔⫷⫸ ⪔⪔ Texas ⪔⪔ iNTUIT qUICKBOOKS SUPPORT Phone Number Moines, Cedar Rapids, Davenport, Sioux City, Waterloo

https://bugs.kde.org/show_bug.cgi?id=371099 Bug ID: 371099 Summary: ⪔⪔nEW yORK⪔⪔⫷1>"844>"414>"4868⨊⪔⫷⫸ ⪔⪔ Texas ⪔⪔ iNTUIT qUICKBOOKS SUPPORT Phone Number Moines, Cedar Rapids, Davenport, Sioux City, Waterloo Product:

[AVKode] [Bug 371098] New: ∭∭ Indiana∭∭ 18*44-41*44*868∭∭ Texas ∭∭ Intuit Quickbooks Payroll Help Support Phone Number Indianapolis, Fort Wayne, Evansville, South Bend, Hammond

https://bugs.kde.org/show_bug.cgi?id=371098 Bug ID: 371098 Summary: ∭∭ Indiana∭∭ 18*44-41*44*868∭∭ Texas ∭∭ Intuit Quickbooks Payroll Help Support Phone Number Indianapolis, Fort Wayne, Evansville, South Bend,

[ark] [Bug 371097] New: Illinois [[[[[18444144868]]]]] Springfield QuickBooks Intuit Technical Support Number Phone Number Chicago, Aurora, Rockford, Joliet, Naperville

https://bugs.kde.org/show_bug.cgi?id=371097 Bug ID: 371097 Summary: Illinois [18444144868] Springfield QuickBooks Intuit Technical Support Number Phone Number Chicago, Aurora, Rockford, Joliet, Naperville Product:

[apper] [Bug 371096] New: New York <%>@<%>1(844)-(414)-(4868) TExas<%>@<%>@ Intuit Quickbooks Point of Sale NUmber Boise, Nampa, Meridian, Idaho Falls, Pocatello

https://bugs.kde.org/show_bug.cgi?id=371096 Bug ID: 371096 Summary: New York <%>@<%>1(844)-(414)-(4868) TExas<%>@<%>@ Intuit Quickbooks Point of Sale NUmber Boise, Nampa, Meridian, Idaho Falls, Pocatello Product: apper

[analitza] [Bug 371087] New: <<@@>> {{{@{{1*844*414*4868}}}@}} Quickbooks Payroll Support Help Phone Number Honolulu, Hilo1, Kailua1, Kapolei1, Kaneohe1

https://bugs.kde.org/show_bug.cgi?id=371087 Bug ID: 371087 Summary: <<@@>> {{{@{{1*844*414*4868}}}@}} Quickbooks Payroll Support Help Phone Number Honolulu, Hilo1, Kailua1, Kapolei1, Kaneohe1 Product: analitza

[amarok] [Bug 371083] New: $$ -€€Georgia€€ - $$ <<<<<@@1-844-414-4868@@>>>>> Intuit QuickBooks Enterprise Support Number Atlanta, Augusta-Richmond, Columbus, Savannah, Athens

https://bugs.kde.org/show_bug.cgi?id=371083 Bug ID: 371083 Summary: $$ -€€Georgia€€ - $$ <@@1-844-414-4868@@> Intuit QuickBooks Enterprise Support Number Atlanta, Augusta-Richmond, Columbus, Savannah, Athens

[akunambol] [Bug 371082] New: [[Florida]] <@><@>1(844)-(414)-(4868)<@><@> Tallahassee Jacksonville, Quickbook Intuit Enterprise Phone Number Miami, Tampa, St. Petersburg, Orlando

https://bugs.kde.org/show_bug.cgi?id=371082 Bug ID: 371082 Summary: [[Florida]] <@><@>1(844)-(414)-(4868)<@><@> Tallahassee Jacksonville, Quickbook Intuit Enterprise Phone Number Miami, Tampa, St. Petersburg, Orlando

[akregator] [Bug 371080] New: Delaware ??@??1(844)-(414)-(4868)??@?? Quickbooks Intuit Support Payroll Phone Number Dover Wilmington, Dover, Newark, Middletown, Smyrna

https://bugs.kde.org/show_bug.cgi?id=371080 Bug ID: 371080 Summary: Delaware ??@??1(844)-(414)-(4868)??@?? Quickbooks Intuit Support Payroll Phone Number Dover Wilmington, Dover, Newark, Middletown, Smyrna Product:

[Akonadi] [Bug 371078] New: Connecticut 1(844)-(414)-(4868) New York Intuit Phone Number Hartford Bridgeport, New Haven, Hartford, Stamford, Waterbury

https://bugs.kde.org/show_bug.cgi?id=371078 Bug ID: 371078 Summary: Connecticut 1(844)-(414)-(4868) New York Intuit Phone Number Hartford Bridgeport, New Haven, Hartford, Stamford, Waterbury Product: Akonadi

[akiirc] [Bug 371076] New: %%% મુખ્યમંત્રીનો %%% {{{@@{{{1 844 414 4868}}@@}}} Intuit Quickbooks pro Tech Support Phone Number

https://bugs.kde.org/show_bug.cgi?id=371076 Bug ID: 371076 Summary: %%% મુખ્યમંત્રીનો %%% {{{@@{{{1 844 414 4868}}@@}}} Intuit Quickbooks pro Tech Support Phone Number Product: akiirc Version: unspecified Platform: Other

[aki] [Bug 371075] New: {{{{Colorado}}}} 1(844)-(414)-(4868) Intuit QUickBooks Support Phone Number Denver QB Intuit QuickBooks Number, Colorado Springs, Aurora, Fort Collins, Lakewood

https://bugs.kde.org/show_bug.cgi?id=371075 Bug ID: 371075 Summary: Colorado 1(844)-(414)-(4868) Intuit QUickBooks Support Phone Number Denver QB Intuit QuickBooks Number, Colorado Springs, Aurora, Fort Collins,

[Active] [Bug 371074] New: <> 1(844)-(414)-(4868) Intuit QUickBooks Support Number Phone Number Los Angeles, San Diego, San Jose, San Francisco, Fresno

https://bugs.kde.org/show_bug.cgi?id=371074 Bug ID: 371074 Summary: <> 1(844)-(414)-(4868) Intuit QUickBooks Support Number Phone Number Los Angeles, San Diego, San Jose, San Francisco, Fresno Product: Active

[abakus] [Bug 371073] New: મુખ્યમંત્રીનો {{{@@{{{1 844 414 4868}}@@}}} Intuit Quickbooks pro Tech Support Phone Number

https://bugs.kde.org/show_bug.cgi?id=371073 Bug ID: 371073 Summary: મુખ્યમંત્રીનો {{{@@{{{1 844 414 4868}}@@}}} Intuit Quickbooks pro Tech Support Phone Number Product: abakus Version: unspecified Platform: Other

[abakus] [Bug 371071] New: Arkansas 1(844)?(414)-(4868QuickBooks Dekstop Software Support Number+Intuit QuickBooks Enterprise Support NumberLittle Rock Little Rock, Fort Smith, North Little Rock, Faye

https://bugs.kde.org/show_bug.cgi?id=371071 Bug ID: 371071 Summary: Arkansas 1(844)?(414)-(4868QuickBooks Dekstop Software Support Number+Intuit QuickBooks Enterprise Support NumberLittle Rock Little Rock, Fort Smith, North

[abakus] [Bug 371070] New: Wyoming <>@<>%<>1~844%414<>4868<>%%<>@@<> Intuit Quickbooks Payroll Support Phone Number Cheyenne, Casper, Laramie, Gillette, Rock Springs

https://bugs.kde.org/show_bug.cgi?id=371070 Bug ID: 371070 Summary: Wyoming <>@<>%<>1~844%414<>4868<>%%<>@@<> Intuit Quickbooks Payroll Support Phone Number Cheyenne, Casper, Laramie, Gillette, Rock Springs Product: abakus

[konqueror] [Bug 336338] Konqueror Crashes at Google.com

https://bugs.kde.org/show_bug.cgi?id=336338 --- Comment #13 from Ronald Santos <ronaldsanto...@gmail.com> --- Created attachment 100619 --> https://bugs.kde.org/attachment.cgi?id=100619=edit New crash information added by DrKonqi konqueror (4.14.7) on KDE Platform 4.14.7 using Qt 4.8.

[konqueror] [Bug 336338] Konqueror Crashes at Google.com

https://bugs.kde.org/show_bug.cgi?id=336338 Ronald Santos <ronaldsanto...@gmail.com> changed: What|Removed |Added CC||ronal