Hello, I have identified (some of the glitches) of the autodock tools and I know upstream to already have worked on it, seriously. This is the pack and grid on the same frame and incompatibility with the numeric library. I'll send them a ping.
Best, Steffen On 07/04/16 23:58, Canberk Koç wrote: > Hello Andreas, > > Thanks for rapid response again i talk with my friend he will send an > introduction email to list. In test issue i'm confused about something > if i delete dh_make section and run adt-run package do automatic test > in built time and give no erors i notice that now but can't figure it > out why already and working on it. Also i make set -e in unit test > file but that fatal eror strings wont exit and work through the end it > is another abnormality i found so i want to give you a little update > about it. > And CC issue i do it right now i think :-) > > Best Regards > > Canberk > > 2016-04-07 9:32 GMT+03:00 Andreas Tille <andr...@an3as.eu > <mailto:andr...@an3as.eu>>: > > Hi Canberk, > > On Thu, Apr 07, 2016 at 04:42:56AM +0300, Canberk Koç wrote: > > >[I think I gave a warning that non-private messages will be > answered on > > >the mailing list and I hereby doing so shamelessly violating > netiquette. > > >It would be great if you would answer on list as well.] > > > > Sorry for miss clicking i forget to reply all. > > No problem. BTW, the mailing list policy for Debian list is to not CC > the original poster but just send to the mailing list. The mail > client > mutt supports "list-reply" (L) to do this efficiently. I have no idea > about other mail clients and whether these might support this. Just > telling you that if you might write on other Debian lists people might > send angry replies for personal CCs. :-) > > > I committed the changes to exonerate package i hope i do it right. > > Yes. You did. :-) I turned your "NMU" into a "Team upload". The > test > suite can implemented in this way. However, when I actually run the > test I get: > > ... > /tmp/exonerate-test.nhNsuB/util/fastasplit.test.sh > <http://fastasplit.test.sh> > Split fastasplit.test.fasta OK > Split into two files as expected > Input len 2136 > Output len 2136 > Input and output lengths match > > /tmp/exonerate-test.nhNsuB/util/fastadiff.test.sh > <http://fastadiff.test.sh> > fastadiff: id mismatch: CALM_HUMAN P53_HUMAN > Different seqs recognised as different > Identity test OK > > /tmp/exonerate-test.nhNsuB/util/fastasubseq.test.sh > <http://fastasubseq.test.sh> > Generated correct subseq > > /tmp/exonerate-test.nhNsuB/util/fastavalidcds.test.sh > <http://fastavalidcds.test.sh> > > ** (process:7647): WARNING **: odd_length length (7) not divisible > by 3 > > ** (process:7647): WARNING **: too_short length (4) not divisible by 3 > > ** (process:7647): WARNING **: no_start missing start codon (has:AAA) > > ** (process:7647): WARNING **: no_end missing stop codon (has:TTT) > > ** (process:7647): WARNING **: in_frame_stop contains in-frame > stop codon (pos:9, codon:TAG) > > ** (process:7647): WARNING **: non_acgt_base contains non-ACGT > base: [pos: 5 base: N] > Validiated CDS sequences OK > >valid_seq > ATGAAACCCGGGTTTTAA > Validated correctly a single seq from input > > /tmp/exonerate-test.nhNsuB/util/fastaindex.fastafetch.test.sh > <http://fastaindex.fastafetch.test.sh> > Made index fastafetch.test.idx > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > CALM_HUMAN > expect 0 > >CALM_HUMAN > MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL > TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE > EFVQMMTAK > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > P53_HUMAN > expect 0 > >P53_HUMAN > MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA > PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT > CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN > TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGR > DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALEL > KDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > A_MISSING_FROM_START > expect 1 > ** FATAL ERROR **: Could not find identifier > [A_MISSING_FROM_START] (missing -F ?) > exiting ... > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > M_MISSING_FROM_MIDDLE > expect 1 > ** FATAL ERROR **: Could not find identifier > [M_MISSING_FROM_MIDDLE] (missing -F ?) > exiting ... > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > z_MISSING_FROM_END > expect 1 > ** FATAL ERROR **: Could not find identifier [z_MISSING_FROM_END] > (missing -F ?) > exiting ... > fastaindex fastafetch test OK > > /tmp/exonerate-test.nhNsuB/util/fastaremove.test.sh > <http://fastaremove.test.sh> > Have calmodulin in input > ** FATAL ERROR **: Could not open list for removal [CALM_HUMAN] > exiting ... > Calmodulin successfully removed > PASS > > > These "FATAL ERROR" strings in connection with "PASS" do not sound > convincing. I wonder whether the build time tests are different > in this aspect. > > > > In MoM issue i want to do it but my mid-term exams start and > they'll finish > > 25 April i can do it after that date. And i want to ask you one > friend of > > mine wants to work it on too can we work together in that project. > > We'd be happy about any volunteer contributing to the Debian Med > project. > > Kind regards > > Andreas. > > -- > http://fam-tille.de > > > > > -- > > -- > > Canberk Koç > https://about.me/canberkkoc > > <https://about.me/canberkkoc?promo=email_sig&utm_source=email_sig&utm_medium=email_sig&utm_campaign=external_links> >