[Elecraft] test sri cu at dayton

[bill steffey ny9h]

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] k pod repair

[bill steffey ny9h]

one of my f switches is intermittent...    reloading the macro did not 
help at all


anyone know the mouser or digikey part number 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Reversed K4 Rear Panel Drawing

[Bill Steffey NY9H]

for my K3 I made a reverse upside down  copy from the manual, and placed 
it on the top cover rear  ...


it showed a top down drawing so I could reach back and all would be in 
proper order top to bottom...


yet to do for my k4,,,


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] NOT ENOUGH COM PORTS ????

[Bill Steffey NY9H]

WITH MY NEW k4   have no need for this CAT router.   works great with 
K3  providing


provides extra RS232 ports & USB    for logging, amplifier ETC,,,

 * Radio RS-232 to USB interface
 * 3 additional RS-232 ports to route radio data to your amp and other
   accessories
 * Selectable baud rate
 * Forwards RTS and DTR from all ports to radio
 * Compatible with Kenwood, Elecraft, and Yaesu FT-2000 and later radios.


https://www.arraysolutions.com/cat-router 
http://www.hamation.com/CATRouter.html


 175 SHIPPED TO USA


TNX

BILL



__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Band pass filters

[Bill Steffey NY9H]

well said

at field day  that famous SDR, very reasonably priced, abundant with 
features DID INDEED SPREAD wide band noise ..it was on 10 and wiped out 
all thru 80 meters on three other radios  of various makes. ( mine was a 
k3) ...


maybe all we needed was to have bandpass filters for THAT radio ... but 
4 band of good filters starts to move into the purchase price of that radio


  Sherwood has spoken of this...and hope he will be elaborating ...  as 
I hate being the bearer of bad news



bill ny9h


On 7/27/2021 2:49 PM, David Hachadorian wrote:
You need a filter on the TX radio to prevent its phase noise from 
being heard on other bands.  Just pressing PTT on the TX radio, even 
without putting out any measurable power, will raise the noise floor 
on multiple bands. With suitable band decoders driving filter 
selection, fast-switching between bands is possible.


Dave Hachadorian, K6LL
Yuma, AZ


On 7/27/2021 9:09 AM, CUTTER DAVID via Elecraft wrote:
Given the improved performance of modern transceivers, is there still 
a call for high specification W3NQN band pass filters in a 
2-transmitter station?  For example on a Multi-2 contest 
environment.  For instance K3S + KPA + KAT. The filter fitted between 
radio and amplifier.


I have the *feeling* that a receive-only filter (with tx bypass) 
might be all that is needed.  This is much easier to implement than a 
full transmitter-rated set making fast switching between bands (eg 
for a quick look around) very quick and easy from the keyboard, etc.


David G3UNA
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to k6ll.d...@gmail.com
.



__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] KAT500 ANT1 problem

[Bill Steffey NY9H]

I'll bet he meant Amphenol

On 7/12/2021 12:01 PM, Hugo Loranger wrote:

Hi Jim,

So Amphenol, DX Engineering, RF Industries, Times Microwave, Andrews, are not 
recommended?

Only Belden?



Hugo

Message: 13
Date: Sun, 11 Jul 2021 21:05:21 -0700
From: Jim Brown mailto:j...@audiosystemsgroup.com>>
To: elecraft@mailman.qth.net
Subject: Re: [Elecraft] KAT500 ANT1 problem
Message-ID:
 
mailto:ec5ede20-52e9-33a4-677a-2fd2c60fd...@audiosystemsgroup.com>>
Content-Type: text/plain; charset=utf-8; format=flowed

On 7/11/2021 1:52 PM, Dave wrote:

What had apparently happened was that I had a batch of the offshore made
"Amazon Special" PL-259s that appear to have a slightly oversize center
pin.

For several decades, I've served on the Standards Committee of the Audio
Engineering Society with representatives of the two best mfrs of audio
connectors -- Switchcraft and Neutrik. Both report having had problems
with counterfeits of their parts, and that out of tolerance pretty
common. Some major mic mfrs, both US and EU, have reported
counterfeiting of their products.

Years ago, I learned that cheap, no-brand connectors are a very
expensive mistake. When I got back on the air in 2003, I stocked up with
several dozen adapters that, over the next ten years caused me no end of
grief.

In North America, if a UHF, BNC, or type-N connector isn't branded
Belden or stamped with a MIL part number, it's junk.

73, Jim K9YC
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] K4 Lore

[Bill Steffey NY9H]

On 6/4/2021 1:19 AM, Jim Brown wrote:

On 6/3/2021 9:40 PM, John Nicholson wrote:
Yes and no; both the IC-7610 and FTdx101 models include an internal 
tuner without an optional charge.


From its beginnings, a key element of Elecraft's business model has 
been to make their products modular, 




"" users can buy only what they need, "" sounds like a very 
Progressive" idea  ( Progressive Insurance TV ad ) .Emu & 
Dave..




BTW -- Yaesu rigs have long been notorious for clicks and they now 
exhibit serious splatter on SSB. Older ICOM rigs were about half as 
back for clicks.


73, Jim K9YC




__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] using secondary HDMI screen ....

[Bill Steffey NY9H]

Will this work ??

using a waveshare 7" touchscreen screen for a rasberry pi .. also my 
RFKIT LDMOS amp.


does it seem doable to use the touch feature on this 60$ screen hooking 
the Waveshare's USBmini (touch ) to a USB on the k4



As I plot my station for the arrival of a K4 !!!

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Demure Request

[Bill Steffey NY9H]

sorry    It looks like my friend Dave  has been hacked  BADLY... with 
the amazon scam . "i need a gift card for my relative "


I don't even know that is return is really Dave's email   or just to the 
scammer.




another friend on comcast had     all of his emails ALSOI going to a 
hacker  ...


SORRY FOR THE BANDWIDTH    i am sure Dave will see this here
bill ny9h/3


On 5/12/2021 3:51 PM, DAVID HEWITT wrote:

  - This mail is in HTML. Some elements may be ommited in plain text. -

Hello there!
sorry to bother you,do you have an account with amazon?
Thanks
DAVID
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Sherwood Engineering

[Bill Steffey NY9H]

looks like he is working on his "" Receiver Performance page

On 5/5/2021 8:42 AM, Mike Cox wrote:

Check  for his information.

...Mike, AB9V

On 5/5/2021 8:28 AM, Richard Donner wrote:

I noticed that sherweng is gone from the internet.
Anyone have information about this?
tu
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to m...@ab9v.us

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] K4 whining

[Bill Steffey NY9H]

I thank Mike for this subject line, and would request that all whining 
follow on with this subject line.


This will allow me to appropriately send all said subject line to it own 
email folder.


I can speak to this as I did plop down all the bucks at Dayton.


bill  ny9h


On 3/31/2021 3:25 PM, Mike Smith VE9AA wrote:

I did not put down a deposit on a K4.  When I heard about the first case of
Covid, that stopped me in my tracks.  Yes, I know many weren't so lucky and
put $$ down at "Dayton".

  


I watch the videos from Elecraft or read the great synopsis from fellas like
Kimo, KH7U(and others) and read the mail on the various email lists here and
there to get an idea when the K4 might be available.

I am actually holding out for a K4HD (or 2!) to do SO2R contesting.

  


I don't think you'd want even BI-WEEKLY updates from a company struggling to
meet demands.

What company would do that anyways? If you are not aware of what they've
been up against, you must have been living under a rock the past 16 months.

  


Nearly everyone understands what it takes to make a K4 and why they just
can't supply one at this moment.  I am sure they'd love to ship 5000 units
this week, IF THEY COULD.

  


Covid-19, wildfires, staff sickness, staff retirements, price increases,
product redesign and probably more that we have no idea about or have any
business knowing.

  


So, why don't you fellas please cut them a little slack and if you're really
just mad and can't get over it, just apply to get your $$ back and go buy a
YaeKenCom radio or 40 year old Heathkit.

  


The whining is getting loud.

  


No amount of it will help.

  


Mike VE9AA

  


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Mic headset for K3

[Bill Steffey NY9H]

hey Jim,

maybe we can start a trend to get all the essb & AUDIO guys on ham radio 
to get ribbon mics? since there is nothing "special" about condenser 
mics anymore.


if they think neumann's are cool..  they'd probably want something more 
esoteric like a ribbon ?


now that would go pop very well..

I'd like a sennheiser 441 for the shack , but my ole' AKG paging 
gooseneck microphone works so well.


bill


On 2/22/2021 1:50 PM, Jim Brown wrote:

On 2/22/2021 7:01 AM, Hank Garretson wrote:

But I'm confused about electret versus condenser and which is which and
which does what.


Electret is a more specific description of the condenser mic that is 
in the CM500. Did you miss the long private email I wrote you about 
that? Virtually all ham mics that are condensers are electrets.


73, Jim K9YC
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Big Knob Fail

[Bill Steffey NY9H]

a VERY BIG no-no  is to ship an ICOM 7800 without removing the very nice 
weighted main VFO knob.


IT IS A WELL KNOWN DISASTER TO HAPPEN.  It does not tear up the 
bearing  IT BENDS THE SHAFT    OMG.


 And since the 7800 weighs 80 LBS in the double box, it costs over 100$ 
to ship one way & 200 for insurance.


Never had THAT problem, just twice DSP board failure due to a 5V    
"""surge"" even though the rig on was on a true sine wave 
Uninterruptible EATON 2500VA supply. The first time my HRIA insurance 
paid  almost $1000 for the repair. The second time ICOM management 
agreed maybe the ""problem" was never fixed the first time.



Elecraft k3 WEIGHS nothing...SHIPS EASILY. And does not exhibit issues.

bill  ny9h/3



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] 10 mhz problem ...while running tx gain

[Bill Steffey NY9H]

disregard .   something is amiss in the lines...

time to get out the drawings...

stay well


On 1/28/2021 10:50 AM, Bill Steffey NY9H wrote:

i am very rarely on 10 mHz,



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] 10 mhz problem ...while running tx gain

[Bill Steffey NY9H]

i am very rarely on 10 mHz,


while running tx gain set , the calibration fails at 10mhz due to

  SWR 3.3-1 TOO HIGH FOR CALIBRATION.


checking other bands..160- 6 all read low swr


lp-100 & WATERS swr/load  read low swr .   hi swr  just reads on 
radio & faults the tx gain procedure 



ideas ???


bill


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Different focus

[Bill Steffey NY9H]

I listened to Eric & Wayne proclamations , and did not hear either say 
that  the "subtractive " algorithms were going into the k4.  sooner or 
later.


I believe that that is what BHI uses 



bill

On 1/24/2021 12:07 PM, John Stengrevics wrote:

Evert,

As one who suffers from such noise, I too look forward to such improvements.

The K4 will have a “subtractive” noise reduction/noise blanking algorithm that 
essentially subtracts noise form a signal being copied.  During the recent Zoom 
call, I was told it would be available in about 3 months.

I think you can find a demonstration of this on YouTube somewhere.  It is very 
impressive.

73,

John
WA1EAZ


On Jan 24, 2021, at 11:35 AM,   wrote:

For many years dynamic range and other receiver performance figures (see 
Sherwood) and digital “features” like NB, NR, APF, Notch etc got a lot of 
attention (which was good).

The transition from hardware to software opened a new world of possibilities.

But ….

Today, most of us are battling near-field man made noise instead of receiver 
overload.

Reality tells us that this noise is not going to reduce the next decade or so.

Receivers will outperform competitors if they enable noise reduction and 
improve S/N ratio.

This will be a combi of hardware (antenna’s and receivers) and smart software 
solutions (algorithms etc.)



Just wondering if during the K4 design this “chance” was considered and if so, 
how this was implemented ?



73, Evert PA2KW



(waiting for the K4 kit)







__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to jstengrev...@comcast.net

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Long messages

[Bill Steffey NY9H]

thunderbird...

I made the change to Thunderbird years ago. I hesitated a few years , as 
I remember there was some feature of Eudora that I had to give up 
relating to the folders and sorting ...


life changes ...

HNY


On 1/4/2021 2:02 AM, Dave Cole wrote:
I too use Thunderbird, and it is wonderful.  I look at 40 or so lists, 
each has a folder, and Thunderbird has filters, so they all go 
directly into their respective folders.




--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] test

[Bill Steffey NY9H]

test

On 12/5/2020 4:20 PM, Irwin Darack wrote:

I have an Elecraft XG2 Signal Generator for Sale .

This is a used Elecraft's XG2 3-Band Test Oscillator Signal Generator. The
XG2 uses a crystal oscillator and is ideal for receiver testing, alignment
and S-Meter calibration.

* RF Output Level: 1 µV (-107 dBm) and 50 µV (-73 dBm = S9)
   *Output Accuracy: Typically Better than +/-2 dB at 25 deg. C
* Frequencies: 3.579.5, 7.040 and 14.060 MHz
* Switch selectable output
* Uses a CR2032 Lithium Battery
* Red LED Light used to indicate power on
* Instruction manual included

Asking $70.(or reasonable offer) + Shipping - Con USA Only.

Please contact me off the reflector: idarack(at) gmail.com

Thanks, Irwin KD3TB







Irwin KD3TB
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] K3S MIC Problem

[Bill Steffey NY9H]

MIC ISSUES...

"" The MIC cable (and the K3S) both sit next to an Alpha ""

I think the proximity of the antenna/s is more relevant than the position of 
the amp box.

I don't see a tower in the QRZ page view, so maybe there are some "close to the 
shack" antenna wires ?

bill

 


On 11/23/2020 11:50 AM, Bill Rogers W3UL wrote:

I'm guessing that I'm not the first to notice this on the K3S.  I don't do
much SSB but was active in Sweepstakes this past weekend and noted that
occasionally the audio would go dead.  Looking around I found that the MIC
gain had dropped from the usual (about 16) down to zero.  I placed a toroid
around the MIC cable and this seemed to prevent the problem most (but not
all) of the time.
87A amp.  I don't recall reading about this. Is some protective function
being activated?



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] K3S RX OUT

[Bill Steffey NY9H]

mfj makes a little box that does just that  
https://mfjenterprises.com/products/mfj-1708b-sdr



good to see you on nidxa zoom

stay well

On 11/14/2020 11:38 AM, Alan - G4GNX wrote:

There's no reason why you can't do this.

You would however have to be very careful that the SDRPlay is isolated 
when you transmit. Not just removing power to it, but also grounding 
the SDRPlay input. This is not because there's any issue with the K3, 
but because you can still set up a high energy field that can destroy 
the SDRPlay.


73,

Alan. G4GNX


-- Original Message --
From: "Jim McDonald" 
To: "Elecraft Reflector (elecraft@mailman.qth.net)" 


Sent: 14/11/2020 16:31:42
Subject: [Elecraft] K3S RX OUT

Can an SDR, such as a SDRPlay RSP1A, be connected to the RX OUT jack 
on the K3S instead of using the IF OUT (on the radio or the P3)?


73,  Jim N7US



__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] CM-500 dynamic mic vs electret

[Bill Steffey NY9H]

in our ham classes  it's very easy to explain dynamic mics...

it is just a speaker  !!!  so if you apply a bias voltage it will try to 
push the dynamic element   ( speaker cone) in or out & HOLD IT   
making it difficult for audio to create an AC alternating current on 
that same , (now DC biased) voice coil.



Many a speaker has been forced into service as a microphone, and is a 
frequent design element as both in an intercom.



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] K4 Pricing Posted

[Bill Steffey NY9H]

where did Yaesu make the new 101 

On 10/3/2020 10:08 AM, Macy monkeys wrote:

I have the FTdx101D. It wasn't made by workers in America and I don't have a 
pipeline to the designers. Those two things alone might be considered worthy of 
the extra expense. But K4 performance will be proof of the pudding.

John K7FD


On Oct 2, 2020, at 9:09 PM, Dave  wrote:

I was disappointed to see the pricing for the K4. I thought the base K4 would 
be in or around $3500 to $3700 and perhaps $500 or so to go to the K4D. As it 
turns out, another $900 for the K4D. These prices do not include the ATU ($400) 
or even a hand-held Mic. The total for the K4D that I was thinking of 
purchasing would have been almost $5470. (+shipping ??) it’s out of my price 
range. It will be interesting to see what the K4HD goes for. I’m glad that I 
had my $1500 deposit refunded several months ago. I have to wonder if one will 
really be able to tell the difference between any K4 and the FTDX101D which can 
be purchased for under $3000 and includes the ATU and a Mic

I hope you folks enjoy the K4 as I’m sure it will be a great radio. I will 
continue to use my K3s as the price for that fine radio is dropping like crazy 
and has allowed me to pick up a second one for a surprisingly low price.

73,
Dave N8AG

Sent from Mail for Windows 10

From: elecraft-requ...@mailman.qth.net
Sent: Thursday, October 1, 2020 7:20 AM
To: elecraft@mailman.qth.net
Subject: Elecraft Digest, Vol 198, Issue 1

S

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to macymonk...@charter.net

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] K9YC

[Bill Steffey NY9H]

Glad your home made it thru the fires hope you get home soon !!!

Very Great to hear you were awarded the ARRL Tech Services Award..   
you certainly earned it.


http://www.arrl.org/news/arrl-technical-service-award-conferred

It's fun to see you and a few other brains here keep some of the "myths" 
quiet.  Especially the audio related .


As Jim moved to California from Chicago he scooped up my TenTec Titan to 
start his "Titan" collection. Jim & I go back to the audio business in 
Chicago 1980s/90s...   glad I can say this smart cookie is a friend.


bill ny9h/3


Have you been able to get home yet? What's the status of your home and 
antennas?


Got back a few days ago, only damage is to floor under refrigerator 
that had been without power for 3 wks. House, shack, antennas all 
fine. No power, water, or internet, so we're in a rental townhouse for 
a while.


73, Jim K9YC



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] Fwd: Re: K4 -- Spectral subtraction noise reduction

[Bill Steffey NY9H]

I do believe that  BHI Ltd  ( Graham)  has been using that for years... 
  check out their website . Under downloads there are several examples 
of how well it works,.( really well...) 
https://www.bhi-ltd.com/downloads/sound-files/


I always have been suggesting to Eric & Wayne to look at the BHI 
algorythm ...  patented ?? maybe it has a license fee ??? but it works 
substantially better than 'clearspeech" and the rest of them. Till 
recently GAP was the US distributor of the BHI products, then Graham 
finally started doing US marketing himself...a much better job.


Used to use BHI speakers on my Microham mk2r connected to K3 & 7800, as 
it was markedly better at NR. Now I have the Parametric/NR box feeding 
some 3" realistic box speakers.


+
On 9/11/2020 9:32 AM, Kurt Pawlikowski wrote:

Grant,

    You peaked my interest. I attempted to find examples of spectral 
subtraction and only found talks about it (no audio examples). Would 
you happen to know where I might find some examples? Maybe comparing 
results between several noise reduction methods?


    Thanks!

    kurtt WB9FMC

On 9/10/2020 11:19 PM, Grant Youngman wrote:
I’ve recently been exploring quite a few of the many SDR receivers on 
KiwiSDR.  One of the (many) features of this system is an option to 
select spectral subtraction NR.


I’m now really hyped about the fact that this will be available at 
some point on the K4.  It works exceptionally well.  So well, that I 
leave it turned on most of the time. Often, stations you can barely 
copy down in the junk literally pop up out of the noise.  Don’t know 
if this will be available at initial shipment, but it’s certainly 
something to look forward to if not.  I’ve only tried it on AM and 
SSB at this point, so not sure about CW.


Just something else to whet the appetite for that eventual “you’re 
up” email from Elecraft sales …  :)


Grant NQ5T
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to ku...@pinrod.com

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] [Elecraft-KX] Help! MH3 mic PTT broken, fixable? - ELECTRET MICROPHONES

[Bill Steffey NY9H]

most ANY electret microphone element will be excellent for use with ham 
radio. The Panasonic are among the most expensive ( 8pcs New WM-61A 
Panasonic Electret Condenser Mic Capsule Mic   )   on ebay


That leaves the case cord and plug for the "mic" factory to finish. Many 
of the fake 'icom" mics I have bought on line have had the vinyl ( NOT 
RUBBER)  coil cord DISINTEGRATE into peices 3-4 years later. Never has 
issues with switches or the cases. Remember some rigs , especially ICOM 
need the higher output level found with an electret, as they are 
designed / supplied with an eletret.  Elecraft , in their wisdom, 
provides enough gain so while electrets work, there is enough gain to 
easily use a dynamic microphone. Remember when Heil sold microphones for 
icoms that were way too low on gain. So bob then sourced mics with 
electrets ( higher gain) for icom.


I spent 20+ years working under contract for ( in order) Sennheiser 
1976-81; AKG 81-86 Shure 86-91...while I am not an engineer one learns 
much along the trip.


bill ( now using an AKG gooseneck paging microphone in my console    
pix at qrz.com)





--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Convert a KXUSBa cable to KUSB

[Bill Steffey NY9H]

db 15  or db9 ( DE9)


On 7/17/2020 9:20 AM, Bill Cotter wrote:
Somehow in the entropy of the universe and my cluttered shack/shop, I 
have managed to lose my KUSB cable for my K3. I found the earlier 
(silver) cable, but it doesn't have the FTDI chip and won't work with 
Win-10. In the process of searching for the KUSB I have managed to 
unearth two KXUSBa cables for my KX3.


Since I don't need two KXUSB cables, I am contemplating cutting off 
the mini phone plug and wiring up a DB-15. Has anyone done this? And, 
anyone see a downside?


Thanks es 73 Bill N4LG

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Convert a KXUSBa cable to KUSB

[Bill Steffey NY9H]

heck    for 13 $ you can get another  usb rs232 ftdi cord


Sabrent USB 2.0 to Serial (9-Pin) DB-9 RS-232 Adapter Cable 6ft Cable 
[FTDI Chipset] (CB-FTDI)




   Sabrent USB 2.0 to Serial (9-Pin) DB-9 RS-232 Adapter Cable 6ft
   Cable [FTDI Chipset] (CB-FTDI)
   


/4.6 out of 5 stars/322 


$12.21$12.21
FREE DeliveryWed, Jul 22



On 7/17/2020 9:20 AM, Bill Cotter wrote:
Somehow in the entropy of the universe and my cluttered shack/shop, I 
have managed to lose my KUSB cable for my K3. I found the earlier 
(silver) cable, but it doesn't have the FTDI chip and won't work with 
Win-10. In the process of searching for the KUSB I have managed to 
unearth two KXUSBa cables for my KX3.


Since I don't need two KXUSB cables, I am contemplating cutting off 
the mini phone plug and wiring up a DB-15. Has anyone done this? And, 
anyone see a downside?


Thanks es 73 Bill N4LG

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] "On second thought, I'll take the stairs."

[Bill Steffey NY9H]

wow  ...  he is so young !!!   I am so old,,,

I was just browsing thru several months of 1955 Pop electronics and 
reading the Carl & Jerry stories.


Here are ALL the PE magazines starting in 1954

https://worldradiohistory.com/Popular-Electronics-Guide.htm

Of course they save the world, with elecrtonics.


bill


On 7/12/2020 2:49 PM, Wayne Burdick wrote:

Hi John,

Thanks for bringing Carl and Jerry to my attention. I'd never heard of until 
now (born too late, apparently). Here's a fascinating article about these 
fictional characters, from Popular Science, circa 1960:

http://www.copperwood.com/carlandjerry.htm

73,
Wayne
N6KR



On Jul 12, 2020, at 8:56 AM, John  wrote:

Thanks Wayne.

Reminded me of Carl and Jerry.

73.

John.

ve7day.


On 12/07/2020 8:07 a.m., Wayne Burdick wrote:

I have a friend about my age who got into amateur radio only a few years ago. 
Like many of us, he was enthusiastic about the technology. Intrigued with DX.

I showed him my station; we talked endlessly about gear. Later, I helped him 
put up a simple wire antenna.

Then, when his license arrived, he dove straight into FT8 and didn't look back. 
Within days, he'd worked all states, then DXCC. He'd bag a few rare ones over a 
light lunch, then pat his laptop on the back and congratulate his software app 
for its near-mythical ability to extract weak signals out of noise.

Within weeks, he'd mastered everything there was to know about this glorious 
new hobby.

Point. Click.

In this new world order, those of us who took the longer, slower path to 
ionospheric enlightenment -- and who still occasionally enjoy making waves by 
hand -- often fail to explain why.

I had failed to explain it to my friend. Even as hints of his boredom crept in, 
creating an opening, the best argument I'd made for trying CW was that he could 
do it without a computer. Coming in a weak second was the notion that CW was 
the original digital mode. For obvious reasons, I didn't bother with the 
classic argument about CW's signal-to-noise advantage over SSB.

I had all but given up.

Then, in a moment of delayed clarity, I decided on a different approach. I 
invited him to a weekday brunch. A bit of an escape. He willingly took the bait.

On the appointed day, arriving at his workplace, I bypassed the lobby's 
glistening elevators and climbed the four flights of stairs to his office. I 
insisted we take the stairs down, too.

"Why?" he asked. "And how'd you get up here so fast?"

I pointed out that I always chose stairs, when possible. That's why I wasn't 
out of breath. We hustled down, jockeying for position, and emerged on the 
ground floor invigorated by the effort.

"So, where are we going?" he asked. We'd been to every overrated twenty-dollar 
burger venue at least twice.

I replied that we'd be going someplace we'd never tried. My kitchen.

When we arrived, I put him to work chopping onions and broccoli and squeezing 
oranges while I whipped eggs into a froth and grated Swiss cheese. We ate our 
omelettes outside, in full sun and a cool breeze.

"What's for desert?" he asked. "Isn't there a frozen yogurt place a two-minute drive 
from here?"

I had something else in mind. Back in the kitchen, I handed him a water bottle, 
then strapped on a small pack I'd prepared earlier.

We walked a mile or so through my neighborhood, admiring the houses' varied 
architecture, ending up (as planned) at a local park festooned with blackberry 
bushes. The most accessible branches had been picked clean, but with teamwork 
and persistence we were able to gather several large handfuls of fat, ripe 
berries, which we devoured on the spot.

We'd been poked and scratched but didn't care.

"Doesn't brunch usually end with champagne?" he wondered aloud, admiring his 
wounds.

Not this time. I pulled out two bottles of craft beer that I'd obtained from a 
neighbor in trade for repairing his ancient home stereo. Carlos had spent years 
crafting an American pilsner to die for, sweating every detail, including 
iconic, hand-painted labels.

My friend accepted the bottle, then tried in vain to remove the cap. Not a 
twist-off.

"Opener?" he said.

I handed him a small pocket knife, an antique without specialty blades. He soon 
discovered it could not be used to remove the cap directly. He looked at me 
with a bemused expression, no doubt wondering what I had up my sleeve this time.

I pointed out that we were surrounded by white oaks, a species known for its 
hard wood. He got the message, smiled, and began hunting. Within seconds he'd 
collected a small fallen branch. I watched as he used the knife to fashion a 
few inches of it into a passable bottle opener. We popped the caps, toasted his 
new-found skill, and traded stories of our misspent youths.

"Oh, one more thing," I said.

I pulled a KX2 out of my pack, along with two lengths of wire. Of course he 
knew everything there was to know about Elecraft, and me, so he wasn't 
surprised when I also 

Re: [Elecraft] OT Slightly K3s and Studio Mixer

[Bill Steffey NY9H]

check out used RDL  ( radio design labs)  products in the 'bay"... build 
out exactly what you want ..



RDL-Radio-Design-Labs-STM-2-Adj-Gain-Microphone-Preamplifier-35-65-dB-Gain


a whole range of appropriate products,,


On 7/3/2020 9:07 AM, Rich wrote:
I am interested in using a studio mixer so I can use a single mic with 
two K3s.


The mixer output impedance is 150ohms and the K3 mic input is looking 
for 600ohms.


I have seen several articles using studio mixers with two radios but 
none mention using an audio transformer to correct the miss match.


Should I not be concerned about the difference in impedance?

Do anyone have a recommendation on a device to match the the impedances?

Thanks

Rich

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] KPA 500 Codan Envoy

[Bill Steffey NY9H]

maybe the real questions are will the KPA500 work withan ALE 
requirement


Band jumping and other cool stuff are essential for  ALE.

On 6/29/2020 11:52 AM, Mark Goldberg wrote:

I think as a Ham, you can use anything you want on the Ham bands. As a
manufacturer to sell it, it may need type acceptance for the service
it is intended to be used in.

Lots of people use aviation HF rigs on the Ham bands and you can use
an amp that works on 11M or with more than the allowable gain. A
manufacturer can't sell that for use in the Ham bands, but an
individual Ham can use anything as long as it is operated within the
regulations. I know a friend that has a huge amplifier capable of
maybe 10kW. He got a visit from the FCC (long ago, don't think they
care now). He showed them how it was correctly operated within the
regs and how he had the ability to measure it and assure it was. The
FCC guy wished him a good day.

Other services where the operator is not technical and has not passed
a technical exam require radios type accepted for that service as I
understand things.

73,

Mark
W7MLG

On Mon, Jun 29, 2020 at 7:47 AM Lyn Norstad  wrote:

Maybe Bob wants to use the Envoy 2 on the ham bands.  I'm not familiar with
the Codan line of military/business transceivers, but I see that model does
have transmit coverage from 1.6 to 30 MHz.

Perhaps the real question is whether it would be legal to use that rig on
the ham bands.  Since it can apparently cover the 160 - 10m bands without
modification, wouldn't it need to be type accepted?

73
Lyn, W0LEN


-Original Message-
From: elecraft-boun...@mailman.qth.net
[mailto:elecraft-boun...@mailman.qth.net] On Behalf Of Mark Goldberg
Sent: Monday, June 29, 2020 9:09 AM
To: Bob Morgan
Cc: Elecraft Mailing List
Subject: Re: [Elecraft] KPA 500 Codan Envoy

That is not a Ham radio. Is it legal to use an amplifier type accepted
for Ham radio for other services?

73,

Mark
W7MLG


On Mon, Jun 29, 2020 at 6:49 AM Bob Morgan  wrote:

I would like to know if any in the group has used the KPA 500 with a Codan
Envoy 2. Any help would be much appreciated.
Bob Morgan
KJ4SV
865 207 9568



--
Sent from: http://elecraft.365791.n2.nabble.com/
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to marklgoldb...@gmail.com

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to l...@lnainc.com


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] New Heil HM10 XD Microphone - Poor Design?

[Bill Steffey NY9H]

headsets

four years ago while on a bike trip along the Danube, my kx3's headset 
cable broke ... not to fear cause in the next village the locals had a 
6$ computer headset, which I still keep in the kx3 setup. While it does 
have some 'rescue" tape on it it still works great. I don't think 
there is such a thing as a bad electret,,,   Even after a headset 
breaks..steal the electret from it ...cause it works.




--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Future of KPA500 & KAT500

[Bill Steffey NY9H]

what could they do that would  update them  make them taller 
like the K4 


On 6/17/2020 12:47 AM, Don Putnick wrote:

With the sunset of the K3S, what are the plans for the future of the KPA500
and KAT500? Enquiring minds want to know.
73 Don NA6Z
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] K3 - No RF output

[Bill Steffey NY9H]

DOES k3 xmit ssb with a mic in usb ?

what mode ( TXDATA) are you using ...

usually when I have that symptom, turns out that computer sound card is 
NOT putting out TX audio to rig.



On 6/15/2020 4:04 AM, G4BVH wrote:

Hi,

  


I have had a fault develop on my K3 whereby there is no RF being produced. I
have emailed the details to Elecraft support and am hoping to receive a
reply with suggestions. However, I thought I would also send the details
here in case anyone can suggest something to try or investigate further.

  


I have a K3, serial number 6482 which I built from a kit. It has worked
flawlessly since I built it. I have the 400Hz and 2.7kHz (2.8kHz?) filters
fitted and the 100W module but no other additions.

  


A few days ago, it was running 20W of FT8 and I suddenly discovered that it
hadn't been transmitting. Everything appeared that it should be
transmitting: the red TX LED was lit, it was not in TEST mode (TX not
flashing) but there was no RF output displayed on the bar graph and
definitely nothing coming out on any mode. There is no RF if I wind down the
power below the 10W level, there is the usual relay click going through 12W
- 13W and still no RF above this level, ie on towards 100W.

  


The K3 metering shows 13.5V and 0.84 on receive, 0.97A on the lower power
level setting and 1.18A on the higher power setting on transmit. The RF
output bar graph always displays 1 bar on transmit no matter what the power
level  is set but there is no RF coming out.

  


I tried the TX calibration but it fails saying the power level didn't reach
that required.

  


The receiver works fine and I can hear the CW side tone and SSB, AM and FM
audio monitoring as normal.

  


I have removed and reseated the front panel and also the 3 coax patch leads
behind the front panel but this made no difference. There is a yellow LED,
D33, on the main board which is lit on receive and goes out on transmit.

  


The latest firmware is installed - I updated this a month or so ago.

  


TX inhibit is OFF and the 20A breaker has not tripped.

  


Any thoughts or suggestions gratefully received.

  


Very many thanks and 73,

  


Peter, G4BVH

  

  






--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] K3 on motorboat.

[Bill Steffey NY9H]

looks like they are hunting for military business... the element 
looks like one of those on the big Chernobyl over the horizon antenna... 
broadband.. https://www.youtube.com/watch?v=WjoPy6drGBQ



bill

On 6/10/2020 9:02 AM, Donald Wines wrote:

Apparently they are a two person company located in Oakwood, TX a small
town of about 3000 good folk located about an 1-1/2 hours southeast of my
QTH in Bullard, TX.
You can check them out here
https://www.corporationwiki.com/p/2s9ylr/advanced-hf-solutions-inc.
The price on this thing is almost $10K.

Don,
K5DW


On Wed, Jun 10, 2020 at 7:19 AM  wrote:


Where is this company?  I dd not see any information about them on the
website.

John KK9A



Michael Chowning N8TTR wrote:

https://advancedhfsolutions.com

 Mike, N8TTR

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to k5dw...@gmail.com


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] K3 on motorboat.

[Bill Steffey NY9H]

googling shows alot of legal activity,, maybe charleston, 
SC   too much reading for me .


On 6/10/2020 8:23 AM, Victor Rosenthal 4X6GP wrote:

Probably Nigeria.

Here is a patent for  something:


73,
Victor, 4X6GP
Rehovot, Israel
Formerly K2VCO
CWops no. 5
http://www.qsl.net/k2vco/
.
On 10/06/2020 15:18, j...@kk9a.com wrote:
Where is this company?  I dd not see any information about them on 
the website.


John KK9A



Michael Chowning N8TTR wrote:

https://advancedhfsolutions.com

    Mike, N8TTR

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] Self-fusing liquid electrical tape

[Bill Steffey NY9H]

1 TOWER   6000-20 k      1HOLE  WITH CONCRETE $1000

HUNDREDS OF FEET OF LMR 600   ,  RG213   ETC

4 ANTENNAS    $1600

ROTOR  1600

cadwelds for the 9 10 BURIED ground rodsat the tower   and few more 
at the house MUST be in the budget.


why stray from a great job for a few hundred bucks.   CADWELD.

On 6/5/2020 2:55 PM, Bob McGraw K4TAX wrote:
Just look at $11.00 per ground rod connection for Cad-Weld as compared 
to  $1.98 for a mechanical clamp.   Which do you think a ham will 
choose ?
ered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] problem with w2 sensor..

[Bill Steffey NY9H]

it was the rj falt silver cable or connectors    changed it now all 
is good



On 5/19/2020 12:18 PM, Bill Steffey NY9H wrote:
 no fwd power  ,  full swr     and the first led in thwsr display is 
on fulltime, when that sensor is selected


gott dig in and pull that sensor


ideas ... while I dissect///


bill /3






--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] problem with w2 sensor..

[Bill Steffey NY9H]

 no fwd power  ,  full swr     and the first led in thwsr display is on 
fulltime, when that sensor is selected


gott dig in and pull that sensor


ideas ... while I dissect///


bill /3




--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] "subject" & "from" & "reciepient" missing from this email from reflector ????

[Bill Steffey NY9H]

On 5/1/2020 8:10 AM, - wrote:

Hello all,

Thank you for all the help and advice!

A nice gentleman and I are going to meet when I do a feed run to Bryan, TX.  
That will cut
a 5 hour trip to 2.5.  I usually pick up a ton (or more) at a time for the draft 
horses, cattle &
goats. :-)  The plan is for him to do an inventory of the tubes and other 
items.  Then a little
later make them available for others.   I'll pass along the names of the hams 
interested in
the tubes.




i use thunderbird  on win 10. in my INBOX  list of emails ,  the 
above message  is blank .shows no   subject, recipient, or subject ,,,


the source data ( no help to me ) reveals this :

From - Fri May  1 08:10:13 2020
X-Account-Key: account1
X-UIDL: 19d7ae117682ab5e525d492e593f
X-Mozilla-Status: 0001
X-Mozilla-Status2: 
X-Mozilla-Keys:
Return-Path: 
Delivered-To: n...@comcast.net
Received: from dovdir4-ch2h-04o.email.comcast.net ([96.114.154.140])
by dovback4-ch2h-24o.email.comcast.net with LMTP
id 0KKhDnaCq15SXQAASS5ZPw
(envelope-from 
)
for ; Fri, 01 May 2020 01:59:18 +
Received: from dovpxy-ch2f-02o.email.comcast.net ([96.114.154.140])
by dovdir4-ch2h-04o.email.comcast.net with LMTP
id WLNjDnaCq15sZwAAaeF+0A
(envelope-from 
)
for ; Fri, 01 May 2020 01:59:18 +
Received: from resimta-po-12v.sys.comcast.net ([96.114.154.140])
(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
by dovpxy-ch2f-02o.email.comcast.net with LMTP id 2AZGCHaCq141egAAGLhM3A
; Fri, 01 May 2020 01:59:18 +
Received: from pb-mx9.pobox.com ([64.147.108.50])
by resimta-po-12v.sys.comcast.net with ESMTP
id UKxOjiGM2MOEgUKxOjExwS; Fri, 01 May 2020 01:59:17 +
X-CAA-SPAM: 0
X-Xfinity-VAAS: 
gggruggvucftvghtrhhoucdtuddrgeduhedrieeigdehudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihenuceurghilhhouhhtmecufedtudenucenucfjughrpefhvfffkfhojghfggfuphejjfegudeftdhrtgfgshgvsehtjeertddttddvnecuhfhrohhmpehkthehthgvseifrghtvghrshhhihhpfhgrrhhmrdgtohhmnecuggftrfgrthhtvghrnheptefggfelleeiudeifefhleelgeeuieekieejjeetlefgieeujeefheelgefhiedunecuffhomhgrihhnpehqthhhrdhnvghtpdhqshhlrdhnvghtnecukfhppeeigedrudegjedruddtkedrhedtpdeijedrudegfedrudelfedrudehpdeiledrudeirddvvdejrddukeelnecuvehluhhsthgvrhfuihiivgepgeenucfrrghrrghmpehhvghlohepphgsqdhmgielrdhpohgsohigrdgtohhmpdhinhgvthepieegrddugeejrddutdekrdehtddpmhgrihhlfhhrohhmpehsrhhstdeptghmghhkpeeiphepmhgrihhlmhgrnhdrqhhthhdrnhgvthepvghlvggtrhgrfhhtqdgsohhunhgtvghssegsohhunhgtvgdvrdhpohgsohigrdgtohhmpdhrtghpthhtohepnhihlehhsegtohhmtggrshhtrdhnvghtpdhinhgvthepieelrdduiedrvddvjedrudekledphhgvlhhopehmrghilhdrqhhslhdrnhgvthdpmhgrihhlfhhrohhmpeeovghlvggtrhgrfhhtqdgsohhunhgtvghssehmrghilhhmrghnrdhqthhhrdhnvghtqecuuffkkgfgpeehiedtud
X-Antivirus: Avast (VPS 200430-2, 04/30/2020), Inbound message
X-Antivirus-Status: Clean


this happens a few times a week any clues what is going on ??


bill



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] OT: The Colpitts mystery

[Bill Steffey NY9H]

why have an engineer on staff ???    just shop a few services out for 
the best price.


When I got my First Phone I thought I could find great job security  
but I twisted from broadcasting to saleson the way home from my 
first interview with WAAF/WGRT I took a job in the audio industry...a 
career that lasted 40+ years.


and when they wanted my P1 ticket to give me GROL I took a pass, as I 
was NOT going to give that up.


bill


On 4/30/2020 3:58 PM, John Simmons wrote:

Jim,

All the broadcast inspections are now contracted out to private 
companies.


73,
-de John NI0K

Jim Cassidy wrote on 4/30/2020 1:47 PM:
I did all the FCC required licenses at Portland FCC.  General class 
while in High School, all commercial licenses including 3rd class 
radiotelegraph and Amateur Extra around early 1960s.  And with a 10 
year broadcasting career usually yearly visits from McCann or another 
FCC engineer Burson at the broadcast station inspections.


73 KI7Y

- Original Message -
From: "Phil Kane" 
To: "Elecraft" 
Sent: Wednesday, April 29, 2020 7:32:31 PM
Subject: Re: [Elecraft] OT: The Colpitts mystery

On 4/29/2020 5:52 PM, Macy monkeys wrote:


I took my General at the FCC office downtown Portland in the late
60s. The examiner was a tough and gruff staffer named Francis McCann.
IMHO, he was extra tough on 14 year olds, hi. You know my heart was
racing when that series of V's came through those headphones!

Frank McCann was one of the old timers when I joined the agency in 1967.
  By that time he was the Engineer in Charge of the Portland Office but
the EIC did a lot of the journeyman jobs in those smaller offices.  When
he retired in the late 1970s (or was it the early 1980s) I applied for
his job but they had to give it to someone else whose office was being
closed and I continued at the San Francisco Office until I retired in
1995.  I have no idea what happened to him after that.

73 de K2ASP - Phil Kane
Elecraft K2/100   s/n 5402

 From a Clearing in the Silicon Forest
Beaverton (Washington County) Oregon
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to jc_k...@q.com
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to jasimm...@pinewooddata.com


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] KX3/KXPA100 as a mobile?

[Bill Steffey NY9H]

started with a kx3 & kxpa100 to replace an icom 706. But the kx3 would 
not fit between the seats  on my VW..back to the 706.


 and then I picked up a kx2 the first day at dayton. IT FIT.  But wait 
...it fit in the dash, even better.


At a stoplight a lady asked from adjacent car what it that thing on your 
roof. My little tarhill on a quick mount on my roofrack.


How far can you talk on THAT    how about from Walmart's parking lot 
to     KUWAIT.  no wires...no internet..


From my Chicago mobile I have repeatedly worked a Sunday morning net in 
Western PA ( a PEMA net) ...on 80  on that quite small antenna.


For 20 years I had used an ATAS antenna with the 706,  sadly the antenna 
housing oxidised tight and became unservicable. Tried a second 
antenna...it did the same.


The TARHEEL is fantastic and I do take it apart yearly.

pictures of the setup are available on my QRZ page ... midway down the 
page under " PA PICTURES CLICK HERE "



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] fails on 30m only THANKS TO TAX !!!

[Bill Steffey NY9H]

I wiggled all connections & conections,  then I took a small 50ohm load 
and inserted it at the few points from the radio thru my  TopTen relay 
setup    2 radios by two amps to 6 ants ( 5 ants & 1 dummy load).  The 
culprit was my big palstar auto tuner while off , was NOT in bypass.  
With that set properly all is good. Hopefully the only screwup made 
while reconfiguring my station my stay at home project.


stay safe Jim


bill/3


On 4/7/2020 7:59 PM, Jim Brown wrote:

On 4/7/2020 12:43 PM, Bill Steffey NY9H wrote:

Bob prompted what was my next step ..one short jumper to the load..


Expeditioners that do lots of portable setups have repeatedly preached 
that when anything goes wrong in a radio system to ALWAYS suspect a 
bad piece of coax, and usually a bad or poorly installed connector.


Back in the days when I was doing lots of live recording and sound 
reinforcement gigs, it was mic cables. A standard test was to plug a 
mic into the mixer with the cable(s) to test, listen on headphones 
with the gain up, and "rattle" both ends and the cable itself to 
expose any faults. To test coax cables, I'd do something equivalent 
with low power into a dummy load and watching SWR at the rig.


73, Jim K9YC
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] TX Calibration fails on 30m only THANKS TO TAX !!!

[Bill Steffey NY9H]

yepper the radio is fine...  something between the k3  and the waters 
dummyload/wattmeter  did NOT like 10 mHz.


Bob prompted what was my next step ..one short jumper to the load...BINGO

Now I need to find just where that lump of something is hiding . I was 
fooled in that it calibrated up to 10mHz and manually looked good on all 
the other bands...


thanks Bob for precipitating me to do the right thing.

bill ny9h


On 4/7/2020 2:01 PM, Bob McGraw K4TAX wrote:

I’ve found that one should use a 12” to 18” jumper of known good condition and 
quality.  Use this jumper to connect the dummy load direct to the radio. No 
switches, and no tuners in bypass mode.

The dummy load should be 50 ohms +/- 5 (thats 10%)  ohms and be resistive.  
Light bulbs and soldered up resistors and the like,  aren’t resistive, meaning 
no reactance.   Don’t take what’s written on the label as fact!  They change!  
Measure them with an ohm meter and antenna bridge at several points from 1.8 
MHz to 54 MHz.  Anything greater than 1.1 to 1 is out of tolerance.

Run TX Gain cal on all bands.  Your results are only as accurate as your 
procedure and test equipment.

Bob, K4TAX


Sent from my iPhone


On Apr 7, 2020, at 10:59 AM, Bill Steffey NY9H  wrote:

thought it good day to do a tx calibration.

I don't very often use 30 meters..and today the calib quits at 30 meters 
saying  too high for calibration   4.1 swr...

All other bands indicate swr of 1.1 //  except 10mHz...


I looked and the 10mHz low pass filter is shared with 14mHZ... and 20 looks ok. Don't 
know if the problem is in the tuner while in "BYPASS " for the test, or 
elsewhere.   Any help ???  searching found nothing for me.


bill



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to rmcg...@blomand.net



__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] TX Calibration fails on 30m only

[Bill Steffey NY9H]

thought it good day to do a tx calibration.

I don't very often use 30 meters..    and today the calib quits at 30 
meters saying  too high for calibration   4.1 swr...


All other bands indicate swr of 1.1 //  except 10mHz...


I looked and the 10mHz low pass filter is shared with 14mHZ... and 20 
looks ok. Don't know if the problem is in the tuner while in "BYPASS " 
for the test, or elsewhere.   Any help ???  searching found nothing for me.



bill



--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] KPA100 and Audio Issue

[Bill Steffey NY9H]

Rich really meant WATTs.

On 4/6/2020 5:54 PM, Adrian wrote:

I always use 15.6v and with double heavy cable to minimise VD,


On 7/4/20 4:08 am, Bob McGraw K4TAX wrote:
I’d say that 10 - 12 volts is too low. The supply should be 13.8 to 
14.8.


Bob, K4TAX


Sent from my iPhone


On Apr 6, 2020, at 10:52 AM, Rich  wrote:

I am having an issue with distorted audio once the KPA100 kicks in 
at about 10-12v.


The KPA100 is putting out 100 watts

I have re-calibrated the radio with no change.

I am testing with the hand mic and a dummy load.   Which should 
eliminate any external devices causing it


Any suggestions as to what can be causing this issue?

Thanks

Rich

K3RWN

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to rmcg...@blomand.net


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to vk4...@gmail.com

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 


--
This email has been checked for viruses by Avast antivirus software.
https://www.avast.com/antivirus

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] The Big Three... +1

[Bill Steffey NY9H]

Once upon a time there was a radio design that would be the LAST RADIO 
you ever needed... and its receiver design was way far ahead of then 
current "top 3 " designs.  No  old Tenneessee Technical...  it was 
Ten Tec Orion  It was the 'first" to revert back to old "not triple 
conversion"  designs.    Another oldie was Squire Sanders ( check google 
)...lools like similar design


Ten Tec had IT. if ONLY they would have bothered to spend the bucks 
for a programmer to build a decent interface.  I had one on order, and 
drove down & visited the TenTec hamfest /factor tour and Orion Debut  
,,, the set was NOT in the tent as it was inside being checked out, it 
had "checked out" while being demonstrated.


I later cancelled my order , as was the employment of the receiver 
designer   The receiver was GREAT , too bad the rest of the radio 
was not.


another leader that got lost.

bill/3


On 3/29/2020 1:09 PM, donov...@starpower.net wrote:

Charles,



The most competitive contesters -- the subject of this thread -- will always
gravitate to the highest performing radios, not to their favorite brand.


The K3 design is dated, all of the other top manufacturers have introduced
much higher performing SSB radios in recent years. The K3 was a
revolutionary design when it was introduced many years ago, but no more.


Hopefully the new K4 will change the game in Elecraft's favor once again,
especially for the most competitive SSB operators.


73
Frank
W3LPL




- Original Message -

From: "Charles Sells" 
To: "K9FD" 
Cc: Elecraft@mailman.qth.net
Sent: Sunday, March 29, 2020 4:39:40 PM
Subject: Re: [Elecraft] The Big Three...

Merv,

I am curious. If you think K3’s are “losers” then why are you on the Elecraft 
Reflector message board in the first place?

73
Charles
W4PPP


On Mar 29, 2020, at 12:26 PM, K9FD  wrote:

I agree Paul, and my comment was to play the stats in jest.

when the glass is half full you can see it from both sides,

I did that to stir the Elecraft kool aide crew.

Having contested many many years in my past life, I dont own
3 - K3 radios because they are losers, and nope I am not in the
class of any one who qualifies for WRTC. not even close,
and at 75 I am not progressing any longer, I am on the slipping
side of downhill.

73 Merv K9FD

Merv

Now we entering the arena of stats can tell you whatever you want them to tell 
you!

In fairness only one of the top teams was a US team (I think) and 3 of the top 
15 were US. Maybe radio choice for the Europeans is more to do with ICOM et al 
possibly having a more direct sales and support presence in EU versus Elecraft 
which is via local distributors and possibly requiring the gear to return to 
Cal for repair. Just a guess 

I think the WRTC leader role for the Boston/NE one had more US teams placing. 
I’m sure a story exists around home team advantage.

I can only reiterate that anyone who participates in WRTC has to be pretty 
awesome and I wish I had 1% of their skills!!

Stats are fun.

Paul Gacek


On Mar 29, 2020, at 8:50 AM, K9FD  wrote:

SO lets see, we are saying that 50 percent used Elecraft, and out of the top 3 
no one did,
and most who used Elecraft were in the bottom.
So was it the radio or the operator?
If you look at it from one point of view, loosers used Elecraft..

Merv K9FD, and I own 3 - k3 radios so not biased.



Wasn't my subject line. But I'll see your four and raise it to five: Elecraft, 
Flex, Icom, Kenwood and Yaesu.

Wes N7WS


On 3/29/2020 6:55 AM, Michael Walker wrote:
I find you mention the big 3, but it is really the big 4.

Mike va3mw



On Sun, Mar 29, 2020 at 9:28 AM Wes mailto:wes_n...@triconet.org>> wrote:

FWIW. I took a cursory look at the top 10 to see what they were using.

You have to get to 5th place to find a pair of K3s. Sixth and 7th places use
one K3 and something else for the second radio.

So four out of 20 radios were K3s.

Also of interest 6 out of 10 used WinTest with 4 using N1MM+.

Wes N7WS



On 3/29/2020 2:50 AM, Paul Gacek via Elecraft wrote:
If you follow the link you can see what radios the 50+ WRTC 2018

participant teams used.

Lots of K3.

http://wrtc2018.de/competition/finalscores.php

Paul
W6PNG/M0SNA
www.nomadic.blog

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net 

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to va...@portcredit.net 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: 

Re: [Elecraft] question on W2 wattmeter interface application RESOLVED

[Bill Steffey NY9H]

HAD TO DISCONNECT MAIN MONITOR , forcing all the apps to the 2nd & 3rd 
monitor,,


 got the  W2 APP to come off the ceiling... onto main portion of 
screen/// reconnected and all ok ///



sorry for the bANDWIDTH

STAY SAFE

On 3/19/2020 5:50 PM, Bill Steffey NY9H wrote:
I had uninstalled the app. , then cleared the registry , reinstalled 
it   no difference..


Intrestingly , and now i need to rethiink the installation process,,, 
the app does not appear on the taskline , appearing as a background 
app in task manager.


I agree ccleaner is a great tool...

bill

On 3/19/2020 4:29 PM, Rick Bates, NK7I wrote:


Bill,

I don't have a W2 so I cannot comment there, but two things stand out 
that need mention.


1)  Regedit is NOT the place to wipe out a program.  If you (as you 
said) don't know much about Windows, it is however the perfect place 
to make an unrecoverable error and trash the entire computer.  It is 
one of the core elements of the OS.  If you don't understand, don't 
attempt here, it's a dangerous place to learn (by mistake).


2a) The Windows key (four small window panes) with B /_*may*_//__/ 
bring that errant program back into viewing ability. (Windows B at 
the same time)


2b) Use the Task Manager (right click on the taskbar at the bottom) 
to 'End Task' if you can't get the upper right X to kill it. Ending a 
taskwill lose whatever changes you've made in that application since 
starting it but that's often a cause of the issues too.


If you wish to remove a program, uninstall it. If you wish to clean 
or purge the registry of residue (and other things), use 'CCleaner' 
(Crap Cleaner) which will do it with intelligence and safety.  It is 
free but has the (nasty) habit of wanting to stay running in the 
background, so get into the program settings and turn that 'feature' 
off.  You'll be amazed and how much 'stuff' gets purged if you use 
this app.


When CCleaning a _registry_, run the cleaning cycle again until it 
says nothing found.  Removing one old piece in the registry often 
causes others to not be needed as well.  Three times is 'usually' 
enough passes.


CCleaner MAY not get all the folders that installed software leaves 
behind, you have to hunt and dispose of them manually and CAREFULLY.  
Again, this can be a dangerous place to play if you don't understand.


(I've used CCleaner for years, I'm not a shill.)

After you've done this, then you can reinstall the software if you wish.

Now, back to the topic of the W2 software. Practice safe computing, hi.

73,
Rick NK7I

PS


On 3/19/2020 11:56 AM, Bill Steffey NY9H wrote:

STAY WELL ALL..

got my W2s in circuit...   However my interface ( not the utility) 
software finally finds the W2 but the application stays pinned in 
the let top corner of the main screen. Cannot even find the top bar 
to use the X to kill it.


Tried wiping out the regedit , but it manages to stick up there. 
tried a bunch of stuff.


I know this is my windows ignorance.


bill   ( 1 mile from nearest neighbor, both 89 & 93 years old )

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to rick.n...@gmail.com 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

Re: [Elecraft] question on W2 wattmeter interface application

[Bill Steffey NY9H]

I had uninstalled the app. , then cleared the registry , reinstalled 
it   no difference..


Intrestingly , and now i need to rethiink the installation process,,, 
the app does not appear on the taskline , appearing as a background app 
in task manager.


I agree ccleaner is a great tool...

bill

On 3/19/2020 4:29 PM, Rick Bates, NK7I wrote:


Bill,

I don't have a W2 so I cannot comment there, but two things stand out 
that need mention.


1)  Regedit is NOT the place to wipe out a program.  If you (as you 
said) don't know much about Windows, it is however the perfect place 
to make an unrecoverable error and trash the entire computer.  It is 
one of the core elements of the OS.  If you don't understand, don't 
attempt here, it's a dangerous place to learn (by mistake).


2a) The Windows key (four small window panes) with B /_*may*_//__/ 
bring that errant program back into viewing ability. (Windows B at the 
same time)


2b) Use the Task Manager (right click on the taskbar at the bottom) to 
'End Task' if you can't get the upper right X to kill it. Ending a 
taskwill lose whatever changes you've made in that application since 
starting it but that's often a cause of the issues too.


If you wish to remove a program, uninstall it. If you wish to clean or 
purge the registry of residue (and other things), use 'CCleaner' (Crap 
Cleaner) which will do it with intelligence and safety.  It is free 
but has the (nasty) habit of wanting to stay running in the 
background, so get into the program settings and turn that 'feature' 
off.  You'll be amazed and how much 'stuff' gets purged if you use 
this app.


When CCleaning a _registry_, run the cleaning cycle again until it 
says nothing found.  Removing one old piece in the registry often 
causes others to not be needed as well.  Three times is 'usually' 
enough passes.


CCleaner MAY not get all the folders that installed software leaves 
behind, you have to hunt and dispose of them manually and CAREFULLY.  
Again, this can be a dangerous place to play if you don't understand.


(I've used CCleaner for years, I'm not a shill.)

After you've done this, then you can reinstall the software if you wish.

Now, back to the topic of the W2 software. Practice safe computing, hi.

73,
Rick NK7I

PS


On 3/19/2020 11:56 AM, Bill Steffey NY9H wrote:

STAY WELL ALL..

got my W2s in circuit...   However my interface ( not the utility) 
software finally finds the W2 but the application stays pinned in the 
let top corner of the main screen. Cannot even find the top bar to 
use the X to kill it.


Tried wiping out the regedit , but it manages to stick up there. 
tried a bunch of stuff.


I know this is my windows ignorance.


bill   ( 1 mile from nearest neighbor, both 89 & 93 years old )

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to rick.n...@gmail.com 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] question on W2 wattmeter interface application

[Bill Steffey NY9H]

STAY WELL ALL..

got my W2s in circuit...   However my interface ( not the utility) 
software finally finds the W2 but the application stays pinned in the 
let top corner of the main screen. Cannot even find the top bar to use 
the X to kill it.


Tried wiping out the regedit , but it manages to stick up there. tried a 
bunch of stuff.


I know this is my windows ignorance.


bill   ( 1 mile from nearest neighbor, both 89 & 93 years old  )

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com 

[Elecraft] strange request ,,,,, contacts tonight ?

[Bill Steffey NY9H]

for our radio room at our local club
( Washington Amateur Communications - WACOM)
we secured a used K3...added the 100 wt amp and away we go,

We've used members 5 K3s radios at field day successfully, however 
some club members have accused me of drinking too much 
purple  'koolaide" and that

the K3   is too confusing 
so tonight we are having a class , a Lab  a session on  which 5 
controls you need to know...  and tomorrow we get into the other controls 


The goal is to get some of these challenged non-believers into the 
fold & on HF.

I am going to attempt to force them to hit the XMIT button...
about 8:30 Eastern...  14.155 ...  or  7.165..

If anyone is out tuning around and could make certain I can find a 
"good one" for these knwicomyasooo guys, I'd appreciate it.

Some are still HF set less, so I am suggesting a used  K3.

thanks,,,


bill ny9h /3 Washington, PA35 mi SW of Pittsburgh

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] Mobile Radio Dreams & the KX2

[Bill Steffey NY9H]

having used a 706 for YEARS in my VW...
i tried the kx3 mounting it in the lower console down by the 
handbrake, BETWEEN THE SEATS where the 706 head was.
The KX3 with the mic/pwr/ctl lines out the left and the BNC out the 
right, doesn't fit ..too wide. However the KX2 fits even with that BNC .
I had considered taking off the KX3 BNC and putting an sma on the 
left side with the other required connections, with that teflon version of 174.
Enter the KX2, I made a small tray with the 3d printer. So the kx2 
can snap in/out.  The rear / bottom of the mount has a large cutout 
for the audio to get out.
And the 'mount' to the car also has a audio funnel. The KX2 seems to 
be much louder than the KX3...  I do not even need an external 
speakerand my vw sportwagen is loud inside ( road noise))  I 
slide the kxpa100 under my front seat, where it can be removed easily,


only issue i have , system on power up keeps reverting back to amp off...

This week   was working a guy on 80,  I checked and the amp was on
only to discover MUCH LATER   the power was set to 5 wattsI wish 
it would retain amp on and the power. maybe something I am doing wrong...
eventually i'll get some good pictures  KX2 W/ AMP GETS MY MOBILE VOTE 


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] Microphone

[Bill Steffey NY9H]

anyway do note that perusing Digikey & Mouser you will have a hard time finding
ANY electret from the worlds electret makers ,,, that exceeds 
5$  ..(.5 for 3$ )

except knowles a chicago based mfg of tiny mic elements.
the cabinet /enclosure mic body, cable & windsreen add up ...
so make your own  take an old mic  insert electret

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

[Elecraft] Elecraft, Thank you for having a display at W9DXCC

[Bill Steffey NY9H]

I'll third that ,,,

disappointed that I did not see a single device
5 KW amplifier  ( hehe ) ...\

please no flamers...  I know the drill.

TNX Eric & Wayne for coming to Chicago   T'was great.

bill   NY9H / 3




At 07:49 PM 9/18/2016, you wrote:



I will add a second to that.

Bob, K9RHY

From: ni...@yahoogroups.com [mailto:ni...@yahoogroups.com]
Sent: Sunday, September 18, 2016 4:59 PM
To: Michael Rosenberg; elecraft@mailman.qth.net
Cc: NIDXA Reflector
Subject: [NIDXA] Re: [Elecraft] Elecraft, Thank 
you for having a display at W9DXCC





I would like to echo Mike's comments.  Elecraft 
is very supportive of its customers and 
gatherings such as W9DXCC.  I appreciate the 
effort and cost that went into attending W9DXCC and providing raffle prizes.

Jim N7US
Sent from Outlook on my iPad

_
From: Michael Rosenberg 
<mikerosenb...@hotmail.com>

Sent: Sunday, September 18, 2016 3:02 PM
Subject: [Elecraft] Elecraft, Thank you for having a display at W9DXCC
To: <elecraft@mailman.qth.net>


Just wanted to take a couple of minutes to drop 
a line and say thank you for having a booth at 
W9DXCC this weekend. It was great to meet Dave 
S. and see the KX2 in person. I appreciate your 
making the effort to come to these smaller 
regional gatherings and bring the full line of 
products, answer questions and let us check everything out.



Also, many thanks for being a contributor of raffle prizes.


Best 73s


Mike

N9YB

KX3 #8017
__







__._,_.___

--
Posted by: "Bob Farkaly" 

--


Visit 
Your Group


Yahoo! Groups

• 
Privacy 
• 
Unsubscribe 
• Terms of Use


__,_._,___


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] Mobile Elecraft

[Bill Steffey NY9H]

two weeks ago drove back from Chicago to Pittsburgh area,.,,,
with my kx2 mounted at the bottom of my center console, just above 
the handbrake. VW sportwagen , diesel, with little tarheels on the roof rack.


The KX2 was exciting the KXPA100, which fits nicely under my drivers seat.
While the AMP has a big heatsink , it has no fan noise..advantage.
My KX3 with the bnc out the side was too wide to fit in the defined spot.
It was previously home to an ICOM 706 head, with the radio in the rear

Using a 3D printer I am trying to make a small bracket for the kx2, 
to allow removal of the radio. Still no good result...


Since it is a diesel had no ignition noise, however there are some 
spots in the ham bands which have strong noise from the injection 
system, but noit wideband like spark plug noise.


Just played radio a bit on the trip , as my wife was along, she gets priority.
I did check into the Pennsylvania  PEMA/ACS net on 75 meters 
getting 5x7 reports from central Indiana , which I thought was good 
for a mobile.


The audio from the radio's litty speaker was loud enough in the car 
which is NOT a quiet car. I used a mic I made from a 5$  Chinese 
talkie microphone.



it's a keeper for the mobile & other uses for me 
Also have used the KX2&3 mobile with a JUIMA P100D 100 watt amp.
Using a screwdriver antenna removes the need for any tuner

I may someday pull the BNC and put an sma on the bottom, it would be 
MUCH nicer for mobile use.


bill ny9h /3 


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] OT: RF noise in solar photovoltaic system

[Bill Steffey NY9H]

In 2010 I had installed a 10kw system, about 400 feet down from my tower.
Before selecting SMA as the inverter manufacturer, I went to two 
sites with my little Kenwood TF6A.  It has  am fm ssb  bdcst to 
uhf... using the am broadcast band and built in loop antenna, the 
only noise I could discern was when the handheld was held several 
inches from the inverter cabinet. Nothing heard on other bands. 
Lightning took out the inverters, Thor came into the inverters on the 
RS422 control lines, not the AC outputs, blowing the interface cards 
& control circuity. Insurance covered the replacement  SMA 5000TL 
transformerLESS inverters. Thankfully the loss of transformers did 
not change the cleanliness of the SMA boxes. Being in the boonies, 
allows an s3 noise level...and the SMA do not change that !!!


pix at my google/picasa site
https://picasaweb.google.com/102281425518350961470/SolarElectric

EIS Energy Independent Systems in Pittsburgh did a great job...
.no affiliation other than a customer ...

bill   ny9h/3

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] Now that the K-Pod is shipping,

[Bill Steffey NY9H]

need a longer rj cable for kpod

is there a reason that an rj12 6c straight thru would not work,???

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] R: OT - Neumann vs. Heil Michrophone

[Bill Steffey NY9H]

from a guy who worked for :

 in alpha order

AKG
Shure Bros
Sennheiser


SPEND THE BUCKS ON THE ANTENNA.

get an electret element from RatSchak, put it on the end of a gooseneck lamp
( do take out the bulb)    stuff on an old mic windscreen to make 
you feel good


and tada .   a great sounding 25$ mic system
   2$ for the mic23 for the chrome gooseneck lamp

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

[Elecraft] kPOD

[Bill Steffey NY9H]

Bill


go back to the shop and verify you have latest FW in that K3 !!!

ok,  good idea


bill

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

[Elecraft] got pod... did mod.... no tuning action.

[Bill Steffey NY9H]

did the 6 ohm mod, pwr to the pod is good...
 leds light for the  different tuning vfos..

but no vfo movements on the radio///

something does go beep when I plug in /


ideas

bill   K3 sn 2244

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] K8ZOA SK and Clifton Laboratories

[Bill Steffey NY9H]

way back when the K2  was THE elecraft radio
I bought from Jack a Panadapter,  a kit, quite a kit.
It plugged into a Jack supplied jack on the back of the K2 for an IF tap.
While I enjoyed the scope, continuing my interest in such devices, I 
was blown away at the documentation for the unit. Fold out page by 
page of every circuit, with voltages ac & dc & pictorials of scope 
measurements of almost every junction. Never seen quite as fine a set 
of docs, far beyond the 100+ pages of service manuals from my ICOMS.


Sold the Z-90 panadapter ...but I have his preamp on my Pixel, now DX 
Engineering loop!!!


Someone mentioned he was an ex-tektronixs guy, which I would well believe.

Another great contributor lost to our Hobby-Service-Sport.

bill ny9h

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] k3 various & intermittent errors on power on

[Bill Steffey NY9H]

the usual splendid treatment by howard confirmed my thought ...
get those gold contacts installedtnx
bill

At 12:21 AM 6/20/2016, Eric Swartz - WA6HHQ, Elecraft wrote:

Bill,

Call our support guys first thing Monday.

73,

Eric
elecraft.com
_..._



> On Jun 19, 2016, at 6:14 AM, Bill Steffey NY9H <n...@arrl.net> wrote:
>
> k3  sn 22xx loaded option wise  ( no 2mtr)
>
> last week  vfo did not move receiver ??...
> and heard no sigs  till after i changed bands and back///
>
> upon pwr on   get err codes..
> first  was  KIO
>
> THEN  IF1
>
> PWR DN AND UP AGAIN ,,,
>
> KIO
> IF1
>
> I RELOADED FW THINKING THAT WOULD BE EASIEST ..
> then got the  kio error again/.///
>
> RADIO WORKS FINE
>
> sounds like i need to take it apart and deoxit  everything  front 
panel  and

> reassemble.
> other ideas 
>
> __
> Elecraft mailing list
> Home: http://mailman.qth.net/mailman/listinfo/elecraft
> Help: http://mailman.qth.net/mmfaq.htm
> Post: mailto:Elecraft@mailman.qth.net
>
> This list hosted by: http://www.qsl.net
> Please help support this email list: http://www.qsl.net/donate.html
> Message delivered to eric.swa...@elecraft.com
>


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

[Elecraft] k3 various & intermittent errors on power on

[Bill Steffey NY9H]

k3  sn 22xx loaded option wise  ( no 2mtr)

last week  vfo did not move receiver ??...
and heard no sigs  till after i changed bands and back///

upon pwr on   get err codes..
first  was  KIO

THEN  IF1

PWR DN AND UP AGAIN ,,,

KIO
IF1

I RELOADED FW THINKING THAT WOULD BE EASIEST ..
then got the  kio error again/.///

RADIO WORKS FINE

sounds like i need to take it apart and deoxit  everything  front panel  and
reassemble.
other ideas 

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] Touchscreen and Buttons

[Bill Steffey NY9H]

or just get an Expert  MB-1 get your touchscreen, SDR, WIN 10  etc...
http://eesdr.com/en/products-en/transceivers-en/mb1-en

Tech support will be like working DX not quite Elecraft.

bill


At 07:37 PM 6/5/2016, Bill wrote:

Consider a control program with a Windows 10 touch screen that has excellent
resolution and can be read outdoors, like the Windows surface book or the
pro series.   Excellent, bright displays, decent battery life.

Bill


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] K3 Remote Power On/Off

[Bill Steffey NY9H]

since there IS something in the K3, looking for that power button press,
could not also look for a double hit on some unused serial line ???
That the remote software could employ?


i have had my k3 turned off while remoting,.,,,  multi times...
once i called home and my wife gladly turned it back on...
   she said  'Oh you mean the radio I just turned off.'.

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] Small QRP Xcvr Use Question

[Bill Steffey NY9H]

i would think better is to have an kx3 or kx2 internal tuner ...esp 
one that matches 10-1.

That eliminates weight, a box, cables and fussing...

my kx3 did Verry well on the Danube River bank  with just 18 foot 
wire about 8 feet up in a bush...  no treesssb  ( on a bike trip)


yes  a  10ft counterpoise


bill ny9h/3




At 10:07 AM 5/24/2016, Sandy wrote:
If you don't mind carrying a "load" (If you are not 
hiking/backpacking) I have found the Buddipole/tripod is a very 
excellent antenna from 40-17 meters in the


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

[Elecraft] kpa 500 gain question

[Bill Steffey NY9H]

i see that Expert is proposing to the FCC to eliminate the 15db gain...

SB QST ARL ARLB015
ARLB015 FCC Invites Comments on Petition to Eliminate 15 dB Gain
Limit on Amateur Amplifiers


Wondering how easy a mod ( and firmware) would enable our kx3s
and Elad Duos  to fully drive the KPA500

bill ny9h/3  


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] New Elecraft Product: K-Pod Control Panel for K3S and K3 Transceivers

[Bill Steffey NY9H]

ORDER IN


as they say on "hawaii 50" SHIP IT WAYNO.errr   ah Danno

guess I'll have to wait till Dayton to try out my new acquisition.

bill  H/3 


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] KX3 (or, K3) 2-meter solid-state amplifier

[Bill Steffey NY9H]

 Original message 
From: Phil Hystad  
Date: 09/21/2015  8:06 PM  (GMT-05:00) 
To: "Richard W. Solomon"  
Cc: elecraft@mailman.qth.net 
Subject: Re: [Elecraft] KX3 (or, K3) 2-meter solid-state amplifier 


> On Sep 21, 2015, at 4:55 PM, Richard W. Solomon  wrote:
> 
> Have you looked at Hammond boxes ? Fairly heavy aluminum.
> 
> 73, Dick, W1KSZ
> 

Yes, I have considered them.  Our local industrial supply electronics retail 
store (Vetco)  carries a selection of Hammond Boxes and I didn’t find anything 
suitable.  I also checked the Hammond Web site but again the closest match I 
could find was a bit larger than I wanted (although, if pushed into a corner I 
agree it could work).

They are heavy aluminum — cast aluminum I think.  And, this is one thing I 
didn’t like about them but I guess my reasons for not liking them were a bit 
trivial.

73, phil, K7PEH

P.S.  I should admit that the main reason I am not rushing out to build this 
W6PQL amp is because I haven’t had the spare time and I have this 
back-of-the-head thought that Elecraft would come out with a 2-meter brick 
announcement the day I finished that project.
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] FS: Superb Test Equipment

[Bill Steffey NY9H]

Sent from my Samsung Galaxy Tab® S


 Original message 
From: Howard Ashcraft hwashcr...@gmail.com 
Date: 09/25/2014  9:06 PM  (GMT-05:00) 
To: elecraft@mailman.qth.net 
Subject: [Elecraft] FS: Superb Test Equipment 

Before I post these items on eBay, I wanted to make them available to the
Elecraft community.  I know that there are still a significant number of
Elecrafters who are interested in the experimental side of radio.



Tektronix 2465b 400 MHz 4 channel oscilloscope.  Late serial number.  The
2465b is a legendary scope, one of the best analog scopes ever made.  This
unit is in very nice condition and comes with 2 P6137 probes (correct probe
for this scope)..$700.



HP 8594E 3GHz Spectrum Analyzer with built in tracking generator.  This is
an almost perfect spectrum analyzer for amateur radio use.  It covers the
key bands very well, is easy to use and includes a tracking generator.  This
unit has the high stability oscillator.  $1,000



Rohde  Schwarz CMTA84 Communications Analyzer  100 KHz – 1 GHz.  This is
the star of the show, but hard to truly explain.  Think of it as a Swiss
army knife built by Porsche…  Unlike many communication analyzers, the
individual instruments within the box rival or exceed stand-alone units.  And
unlike later communication analyzers that focus on cellular features, this
analyzer was built for telecommunications.  For example, the power meter
accepts up to 50 watts (with overload protection to 75) and the automated
measurements are useful information, like S/N ratio.  There are many
features to this unit, but some of the most important are.  RF signal
generator to 1GHz.  High precision OXCO (aging 2 x 10 -7/year, temp 2 x
10-9/degree C).  2 AF signal generators.  RF power meter, RF milivoltmeter,
RF and AF Frequency Counter, AF spectrum analyzer, RF spectrum monitor, SSB
analyzer, Demodulators, 15Mhz digital storage oscilloscope, modulation,
Distortion/SINAD meter, s/n ratio.  It is also possible to program the
analyzer to automatically test a transceiver.  I also have the very hard to
find URV-Z7 RF probe for this analyzer.  This unit has front and back
protective covers and is in mint condition.  It is a complete lab in a box.
It also has tone and signaling capabilities.  $1,500



All prices are before packing, shipping and insurance.  Prices are cash or
cashiers check.  Paypal is accepted, but is 3% more to cover PayPal fees.



73,



Howard Ashcraft
W1WF

-- 
Howard Ashcraft
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to n...@arrl.net
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html
Message delivered to arch...@mail-archive.com

Re: [Elecraft] K3 Front Panel

[bill steffey NY9H]

right side panel is 38c,,, ( where two regulators are) and that is 
with the radio somewhat enclosed in a cabinet...


At 03:13 PM 8/19/2013, Paul VanOveren wrote:

Mike, my K3 w/sub rx, at start up, the Front Panel is 15C and the PA temp
is 28, how does yours compare?

PaulNF8J



On Mon, Aug 19, 2013 at 12:02 PM, Mike Harris 
mike.har...@horizon.co.fkwrote:


 61C is not very warm it is too hot to touch.  How does it compare by
 finger with the other unit?  My K3 with sub RX regularly runs at 36  37C.

 Turn the K3 off, let it cool, turn it on with the FP temp display on, how
 does it compare with room temp.

 Regards,

 Mike VP8NO

 On 19/08/2013 12:17, Mike Greenway wrote:

 I just received a new K3 S/N 7604.  I am noticing the front panel is
 running very warm.  It has the second receiver installed so that 
might be a

 reason.  I have another K3 without the second receiver and it is very cool
 with a reading of 36 C for the front panel but the new one is 
showing 61 C.

  The static PA temps compare.  Is this a normal range for the K3 with a
 second RX? The radio are the same other than the 2 nd RX.  Maybe 
some input

 from other users with the second RX.  73 Mike K4PI

 __**__**__
 Elecraft mailing list
 Home: 
http://mailman.qth.net/**mailman/listinfo/elecrafthttp://mailman.qth.net/mailman/listinfo/elecraft

 Help: http://mailman.qth.net/mmfaq.**htmhttp://mailman.qth.net/mmfaq.htm
 Post: mailto:elecr...@mailman.qth.**net Elecraft@mailman.qth.net

 This list hosted by: http://www.qsl.net
 Please help support this email list: http://www.qsl.net/donate.html




--
Paul VanOveren
5911 Snow Av
Alto, Mi 49302
(616) 868-7149
__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html


__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html

Re: [Elecraft] External Speakers for K3

[bill steffey NY9H]

OK   no speaker  since they do not make speakers,,,\
but they could sell an enclosure  , P3 form factor
grille punched out with internal standard mounting studs...
for whatever that size hole could reasonably accommodate
leaving the rest of the space for us to chop up for whatever we want./...

one could even make a subframe to take smaller speakers than the main 
hole would permit... stuff you sdr in the back of your second speaker...

Speakers do have better intelligibility when they are facing you 

I can do speakers, I cannot due a matching enclosure properly,.,,,

bill ny9h/3

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html

Re: [Elecraft] Cheap headphones

[bill steffey NY9H]

Logitech Wireless Headset F540

a gaming headset,.,,,

I was in a fry's store and saw   a bluetooth ? 2.4ghz  boom 
headset  with a receiver

selling for $59.99amazon has for 86$,

had to buy it... it has ins/outs at the receiver for   wiixbox,,,..
going to have to do some rewire to get the mic out (a usb) to a 
usable audio path...
maybe have to run thru a computer .  swing the mic up and it mutes, 
also a mute on the side of mic ..
selects one of two audio sources from the headset   ham or tv 
watcher should be a great solution

for my shack in the den where the tv lives

instore at fry's  59.99

http://reviews.cnet.com/headsets/logitech-f540-wireless-headset/4505-13831_7-34185065.html 




just a thought for those looking for the ultimate ( cost effective) headset

bill  ny9h/3

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html

Re: [Elecraft] Is ham radio a sport ??

[bill steffey NY9H]

talk about exercise and danger  last time I was up at 50 feet 
working on the tower, it was mostly exercise. Danger it was to the 
antenna if you let go.

Suppose if we add tower climbing races to the hobby, then it is a sport,.

bill/3

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html

[Elecraft] kpa 500.... to disassemble or not ?

[bill steffey NY9H]

it is working fine.

just spent the weekend at a shopping mall ham radio demonstration ... w3c

I get the amp home and i head a bit of a rattle...
open the lid and a zinc screw drops out  no washer yet 

To disassemble or not ,
 that is the question

if the screw is part of a heatsink i better open it up 
if it's part of a mechanical fixture maybe 

what would you do ,.,,

i'm pretty certain what I'm going to do .

bill/3

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html

[Elecraft] kpa 500.... to disassemble or not ?

[bill steffey NY9H]

 right behind the front panel is the 'rectifier'  board, home to 
much of the zinc hardware 

tada ...

one of the three missing 

and there was no sign of a star washer on the screw, musta been short .
no I will get one for that.

open it up ... is  was the only choice

:)

bill /3

__
Elecraft mailing list
Home: http://mailman.qth.net/mailman/listinfo/elecraft
Help: http://mailman.qth.net/mmfaq.htm
Post: mailto:Elecraft@mailman.qth.net

This list hosted by: http://www.qsl.net
Please help support this email list: http://www.qsl.net/donate.html

Re: [Elecraft] Elecraft Christmas

[Bill Steffey NY9H]

At 11:51 AM 12/27/2006, Paul Del Negro wrote:

Santa really came through this year (with a little help from the XYL).
I found under the tree:
ppy New Year to all!
73, Paul, N2PD


lucky dude

Santa for got to bring my KPA1500 !
  boo hoo

Merrry Christmas and HEALTHY Happy New  TO ALL...,

bill



___
Elecraft mailing list
Post to: Elecraft@mailman.qth.net
You must be a subscriber to post to the list.
Subscriber Info (Addr. Change, sub, unsub etc.):
http://mailman.qth.net/mailman/listinfo/elecraft


Help: http://mailman.qth.net/subscribers.htm
Elecraft web page: http://www.elecraft.com

Re: [Elecraft] Com port problem

[Bill Steffey NY9H]

i've been successful with used  usb to serial edgeports  very 
expensive new

but very inexpensive on the baysite\

bill

___
Elecraft mailing list
Post to: Elecraft@mailman.qth.net
You must be a subscriber to post to the list.
Subscriber Info (Addr. Change, sub, unsub etc.):
http://mailman.qth.net/mailman/listinfo/elecraft


Help: http://mailman.qth.net/subscribers.htm
Elecraft web page: http://www.elecraft.com