Printing perldocs
Hi all Dumb question but... Does anyone know how to print a perldoc page displayed in the Windows DOS prompt? I can't seem to find the html version of a page I need to print. Hope one of you can help cheers James =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= James Campbell Tel:+44-(0)20-7848-5111 Email: [EMAIL PROTECTED] =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= 'Where shall I begin, please your Majesty?' He asked 'Begin at the beggining,' the King said gravely, 'and go on till you come to the end: then stop.' Lewis Carroll, Alice's Adventures in Wonderland. -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
Complex numbers
Hi All Anyone no if there is a way of getting ActiveState's perl to handle complex numbers? The ActiveState home page has info on Math::Cephes::Complex but when I use ppm3 to try and find this Nothing... Any other suggestions or work-arounds that others have used? Cheers James =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= James Campbell Research Bioinformatician Proteome Sciences Institute of Psychiatry South Wing Lab PO BOX P045 16 De Crespigny Park London SE5 8AF Tel:+44-(0)207-848-5111 Fax:+44-(0)207-848-5114 Email: [EMAIL PROTECTED] Web 1: www.proteome.co.uk (Corporate site) Web 2: www.proteinworks.com (Satellite site - Proteomics facility) =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
RE: Complex numbers - D'Oh!
Anyone no if there is a way of getting ActiveState's perl to handle complex numbers? Does the 'Math::Complex' module, which is part of any standard Perl distribution and which should already be on your harddisk, not suit your needs? -- Shame on me, sometimes I miss things that are right under my nose. Thanks loads. I've just drawn my first Mandlebrot set - I'm so happy James ~:o) =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= James Campbell Research Bioinformatician Proteome Sciences Institute of Psychiatry South Wing Lab PO BOX P045 16 De Crespigny Park London SE5 8AF Tel:+44-(0)207-848-5111 Fax:+44-(0)207-848-5114 Email: [EMAIL PROTECTED] Web 1: www.proteome.co.uk (Corporate site) Web 2: www.proteinworks.com (Satellite site - Proteomics facility) =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
So what is munging?
Hi All Scuse my ignorance (and illiteracy) but what is munging? It seems to crop-up occasionally and I have absolutely no clue... Cheers James =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= James Campbell Research Bioinformatician Proteome Sciences Institute of Psychiatry South Wing Lab PO BOX P045 16 De Crespigny Park London SE5 8AF Tel:+44-(0)207-848-5111 Fax:+44-(0)207-848-5114 Email: [EMAIL PROTECTED] Web 1: www.proteome.co.uk (Corporate site) Web 2: www.proteinworks.com (Satellite site - Proteomics facility) =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
RE:So what is munging?
So it turns out I've been munging for a little while and never even knew it! Thanks for all your replies everyone. James =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= James Campbell Research Bioinformatician Proteome Sciences Institute of Psychiatry South Wing Lab PO BOX P045 16 De Crespigny Park London SE5 8AF Tel:+44-(0)207-848-5111 Fax:+44-(0)207-848-5114 Email: [EMAIL PROTECTED] Web 1: www.proteome.co.uk (Corporate site) Web 2: www.proteinworks.com (Satellite site - Proteomics facility) =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
strange query.
Hi Everyone
I'm having a spot of bother with a query string.
The program below attempts to mimic a web form. It should post the value of
'QUERY ..' to the cgi in $location.
What is actually happening is that 'QUERY ..' itself is being sent as the
value. I copied the name 'QUERY ..' from the textarea name on the original
web form.
I have tried character escaping the space and the two dots but that didn't
work (the cgi hung).
Maybe I need to use CGI.pm to generate the query string?
Anyone got any ideas?
Thanks
James
--
#!/usr/bin/perl -w
use strict;
use LWP::UserAgent;
use HTTP::Request;
#This is the sequence for analysis (it is actually all on one line!!!)
my Seq='MQMRVLRIQHPLDHRPRHDRKTRHEVMLPDRKTRDLVVAIRNDRRA
LRIGAHIQAMPVFRRVQIERRRGVRRMHVADALLNQLRGLRMQFQRHAERGRR
ALTRVVVRRGADAARGEHDVSRGERAPQRRRDALGVVADVLRPAERQPTRAEQ
FDNLRQMLVDPPARQDLIAAKCHCRLFRLVSNSSVGNRRRVPHAAVLFR
AHALQRAQTV';
#Send the request
my $location = http://www.sbc.su.se/~miklos/DAS/tmdas.cgi;;
my $agent = new LWP::UserAgent;
my $req = new HTTP::Request POST = $location;
$req - header('Accept' = 'text/html');
$req - header('Accept' = 'image/gif');
$req - header('Accept' = 'text/plain');
$req - header('Content-Type' = 'application/x-www-form-urlencoded');
$req - content('QUERY ..' = $seq);
#Receive the response
my $result = $agent-request( $req );
print $result-headers_as_string;
print $result-content;
James Campbell
Tel:+44-(0)207-848-5111
Email: [EMAIL PROTECTED]
=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=
'Where shall I begin, please your Majesty?' He asked
'Begin at the beggining,' the King said gravely, 'and go on
till you come to the end: then stop.'
Lewis Carroll, Alice's Adventures in Wonderland.
--
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
news groups and GD
Hi Dudes Two questions for ya. What clients can I use to you connect to comp.lang.perl.modules? I've tired a browser and telnet. had a look in my e-mail client options. No joy. The second question is... Why wont *any* of the versions of GD.pm install on my RedHat Linux box (kernal 7.2)? I'm going to be bald by Friday. I've gone through all the documentation I can find and it seems that the usuall cd /path/to/GD-1.19 perl Makefile.PL make make test make install Isn't working. I get an error at the end of running Makefile.PL saying : cannot find -lm collect 2 : ld returned 1 exit status make : * * * [blib/arch/auto/GD/GD.so] error 1 I get this with and without dynamic linking and also if I try to install it in my home directory (following L.S's instructions.) Thanks is advance - I hope James =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= James Campbell Research Bioinformatician Proteome Sciences Institute of Psychiatry South Wing Lab PO BOX PO45 16 De Crespigny Park London SE5 8AF Tel:+44-(0)207-848-5111 Fax:+44-(0)207-848-5114 Email: [EMAIL PROTECTED] Web 1: www.proteome.co.uk (Corporate site) Web 2: www.proteinworks.com (Satellite site - Proteomics facility) =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
RE:regex tester
Hi
Is anybody use any free Regexp tester?
Like in the OptiPerl - but it's non-free... :(
Don't know how complicated OptiPerl is but if you just want to see what
your regex is matching:
~~~
#!/usr/bin/perl
while () {
chomp;
if (/YOUR_PATTERN_GOES_HERE/) {
print Matched: |$`$$'|\n;
}else{
print No match.\n;
}
}
~~~
Will do it. Feed it a text file by typing
-=-=-=-=-=-=-=-=-=-=-=-=-
#./this_script.pl test_file
-=-=-=-=-=-=-=-=-=-=-=-=-
at the command line.
Good luck
James
=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=
James Campbell
Research Bioinformatician
Proteome Sciences
Institute of Psychiatry
South Wing Lab
PO BOX PO45
16 De Crespigny Park
London SE5 8AF
Tel:+44-(0)207-848-5111
Fax:+44-(0)207-848-5114
Email: [EMAIL PROTECTED]
Web 1: www.proteome.co.uk (Corporate site)
Web 2: www.proteinworks.com (Satellite site - Proteomics facility)
=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=
--
To unsubscribe, e-mail: [EMAIL PROTECTED]
For additional commands, e-mail: [EMAIL PROTECTED]
Do I need a file lock in Win32?
Hi Everyone I've writen a script to copy files from one directory on a remote drive to another directory on another remote drive. All the machines involved are either WinNT4.0 or Win2000. Does any one know if I need to obtain a lock on the source files before they are copied? The files I've tried seem undamaged so far but at some point it is possible that a file could appear in the source directory as the script is being run. If the answer is yes, Is there a way of obtaining a lock on a file residing in a remote directory? Hope someone can help TVM James -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
RE:Installing my own modules
Hi I want to use Image::Size on my site but my Server doesn't have it installed. Place the module wherever you like (and have permission) eg, /home/your/cgi-bin/modules You can then tell perl to look for modules in that localtion with the following: #!/usr/bin/perl use lib /home/your/cgi-bin/modules; use Image::Size; .. . . page 120 of 'CGI Programming with perl' 2nd Edition explains this much better than I can (being a relative newbie an all!) I don't know what sort of Installation Image:Size requires. I don't have a lot of experience with that but it may be as simple as unpacking the files to that directory or you may need to use a Makefile and the make program... or worse... I think if it's that much of a hassle, the admin people will have to do it anyway. Good luck James =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= James Campbell Research Bioinformatician Proteome Sciences Institute of Psychiatry South Wing Lab PO BOX PO45 16 De Crespigny Park London SE5 8AF Tel:+44-(0)207-848-5111 Fax:+44-(0)207-848-5114 Email: [EMAIL PROTECTED] Web 1: www.proteome.co.uk (Corporate site) Web 2: www.proteinworks.com (Satellite site - Proteomics facility) =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
old File::copy Module Installation.
Hi everyone I've got a bit of a problem. I'm stuck with ActiveState Perl version 5.005 build 522 because of lack of support for current versions by a *really* important piece of software I use. I'm trying to install the appropriate File::copy module (for build 522) from ActiveStates respository, I've got it but there is very little help on how to install (unless you use ppm). To confound the problem, the machine that needs the module is on our intranet so there is no way of connecting the ppm to ActiveState. So, does anyone know how to: 1) Set the repository for ppm to a location on my disc? or 2) Install file::copy without using ppm? I've installed modules manually before with a makefile and NMake but there isn't a Makefile included with the pm stuff. Hope someone can help Best wishes James -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
