Re: [MBZ] Bummer For Us

Wow! Can you post a picture? Gerry ~~~ Dimitri wrote: > My parents bought two new Mercedes. A 1971 220/8 and a 1988 560SEL. Still > have the 220 and it's a cream puff. > > Has anyone on this list ever actually bought a brand new Mercedes? > > The only person I can

Re: [MBZ] Chicago moves up

Exactly right; but this is precisely the effect I want if I ever need to use a rifle to defend myself or my family. I would add that modern jacketed hollow-point pistol ammo and any 12 gauge shell are very effective at close range. The reality is that a firearm must do major damage to a determ

Re: [MBZ] Mercedes Digest, Vol 138, Issue 100

Mao, Nothing much to tell. Haven’t been doing much different. Still retired, still own 2 MBs but they’re 10 -12 year old gassers. Had some flooding from all the CA heavy rains in Feb so have been doing repair work. Ugh. :-( Regards, Addison On May 11, 2017, at 12:51 PM, Mountain Man wrote: S

Re: [MBZ] A funny for poos

Aside from my 62 190Dc, that is the only fin car I have seen with a front bench seat. That one would keep Dan busy for a year or two. The bones are all there. Kaleb Striplin via Mercedes May 11, 2017 at 9:23 PM https://www.facebook.com/marketplace/permalink/12647

[MBZ] A funny for poos

https://www.facebook.com/marketplace/permalink/126470564542942 Sent from my iPhone ___ http://www.okiebenz.com To search list archives http://www.okiebenz.com/archive/ To Unsubscribe or change delivery options go to: http://mail.okiebenz.com/mailman/listinfo/m

Re: [MBZ] Bummer For Us

On Thu, 11 May 2017 19:12:25 -0400 archer75--- via Mercedes wrote: > Has anyone on this list ever actually bought a brand new Mercedes? Yes. I bought our '72 220D/8 new from the dealer in Colorado Springs, when they were on East Platte Avenue, in August, 1972. I traded in a 1969 Lotus Europa.

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

On Thu, 11 May 2017 17:10:18 -0500 OK Don via Mercedes wrote: > Not likely, he'll get counseling and need to get some remedial training, > but there's no law against missing the runway :-) Well, Okayy ... Craig ___ http://www.okieben

Re: [MBZ] Was $950 Firm last weekend...

Been looking on and off. Never owned a truck or van in my life but need one on occasion. Found a ML350, dark green, dealer maintained up until the last year or two, in Columbus for $2888 but didn't drive 300 miles to look at it. Found a rusty ML55AMG nearby, burgundy, for something like $1750

Re: [MBZ] Chicago moves up

I have yet to see a .223 or any other g un that just jumps up and sh oots someone. That is analogous to the media attacks on SUVs with anthropomorphism. "An SUV ran off the road and hit a house." It is really a matter of the soul and/or mental health. We used to have a population that went

Re: [MBZ] Chicago moves up

Mitch wrote: > Anybody who says "gun violence" is an expert only on > finding ways to assault civil rights. > That goes double for if they publish in propaganda outlets like > The Trace or Huffington Post. Say it ain't so. I thought they want "civil rights." mao.man __

Re: [MBZ] Bummer For Us

My parents bought two new Mercedes. A 1971 220/8 and a 1988 560SEL. Still have the 220 and it's a cream puff. Sent from my iPhone > On May 11, 2017, at 7:12 PM, archer75--- via Mercedes > wrote: > > Has anyone on this list ever actually bought a brand new Mercedes? > The only person I can thi

Re: [MBZ] 1983 Mercedes Turbo Diesel $1200

"It only comes out at night" Kaleb Striplin via Mercedes May 11, 2017 at 7:18 PM 1983 Mercedes Turbo Diesel http://dallas.craigslist.org/ndf/cto/6119857845.html ___ http://www.okiebenz.com To search list archives http://www.

Re: [MBZ] Looks Like

Dude you are late to the party Sent from my iPhone > On May 11, 2017, at 8:00 PM, clay via Mercedes wrote: > > … I no longer have to feel bad about never purchasing a new car from Mercedes > > > http://www.thetruthaboutcars.com/2017/05/no-mercedes-benz-diesels-2017-maybe-ever/?utm_medium=emai

[MBZ] Looks Like

… I no longer have to feel bad about never purchasing a new car from Mercedes http://www.thetruthaboutcars.com/2017/05/no-mercedes-benz-diesels-2017-maybe-ever/?utm_medium=email&utm_campaign=Benzworld.org_breaking&utm_source=Benzworld.org20170511 clay 2002 s430 - Victor, a Stately & well tailo

Re: [MBZ] Was $950 Firm last weekend...

Yes, so many regrets so little time. Sent from my iPhone > On May 11, 2017, at 7:55 PM, Dan Penoff via Mercedes > wrote: > > That seems to be a reoccurring theme for you. > > I’m just saying…. > > -D > > >> On May 11, 2017, at 8:49 PM, Kaleb Striplin via Mercedes >> wrote: >> >> Are you

[MBZ] Make Parts?

Could this be useful for W123? How to make DIY polyurethane engine mounts https://www.youtube.com/watch?v=2_0BYvTkZ0o mao.man ___ http://www.okiebenz.com To search list archives http://www.okiebenz.com/archive/ To Unsubscribe or change delivery options go to

Re: [MBZ] Was $950 Firm last weekend...

That seems to be a reoccurring theme for you. I’m just saying…. -D > On May 11, 2017, at 8:49 PM, Kaleb Striplin via Mercedes > wrote: > > Are you looking for one? > > I wish I didn't sell mine. What a huge mistake that was. > > Sent from my iPhone > >> On May 11, 2017, at 7:19 PM, Mitch

Re: [MBZ] Chicago moves up

Anybody who says "gun violence" is an expert only on finding ways to assault civil rights. That goes double for if they publish in propaganda outlets like The Trace or Huffington Post. Mitch. > On May 11, 2017 at 8:40 PM Karl Wittnebel via Mercedes > wrote: > > > I read this recently and th

Re: [MBZ] Was $950 Firm last weekend...

Are you looking for one? I wish I didn't sell mine. What a huge mistake that was. Sent from my iPhone > On May 11, 2017, at 7:19 PM, Mitch Haley via Mercedes > wrote: > > I'd rather have an ML from this century, but for this price I'm starting to > consider it... > > https://lansing.craigs

Re: [MBZ] Chicago moves up

They ban guns to protect themselves (the goobers) NOT the citizenry, The last thing a would be dictator wants is an armed populace. Lenin did it, and killed millions of his own, mao did it and killed millions oth their own. I'd guess 'Dolfie did it, he has been attributed to killing 6 mill

Re: [MBZ] Chicago moves up

I read this recently and thought it was a good article about a person who I would consider an authority on the subject of gun violence. You can say what you want about the constitution and forefathers etc, but the view from the trenches is not so pretty: http://highline.huffingtonpost.com/articles

[MBZ] Was $950 Firm last weekend...

I'd rather have an ML from this century, but for this price I'm starting to consider it... https://lansing.craigslist.org/cto/6124715214.html ___ http://www.okiebenz.com To search list archives http://www.okiebenz.com/archive/ To Unsubscribe or change delive

[MBZ] 1983 Mercedes Turbo Diesel $1200

1983 Mercedes Turbo Diesel http://dallas.craigslist.org/ndf/cto/6119857845.html via cPro for Craigslist iOS: http://tinyurl.com/cPro-iDevice Android: http://tinyurl.com/CL-Android Sent from my iPhone ___ http://www.okiebenz.com To search list archives http

Re: [MBZ] Bummer For Us

I believe that's correct about Herr Doktor Booth. One of my work associates ordered a 2017 GLA45 AMG. Yes, ordered it. I think it took four months to take delivery. He loves it. Bob R Sent from my iPhone > On May 11, 2017, at 4:40 PM, Mitch Haley via Mercedes > wrote: > > >> On May 11, 20

[MBZ] I would like to see the crack I am buying

1969 Mercedes 220dl http://amarillo.craigslist.org/cto/6098855351.html via cPro for Craigslist iOS: http://tinyurl.com/cPro-iDevice Android: http://tinyurl.com/CL-Android Sent from my iPhone ___ http://www.okiebenz.com To search list archives http://www.ok

Re: [MBZ] 123 diesel convertible

Ah, going topless . . . On Thu, May 11, 2017 at 6:51 PM, Kaleb Striplin via Mercedes < mercedes@okiebenz.com> wrote: > > > 1978 Mercedes 300cd > http://oklahomacity.craigslist.org/cto/6109898561.html > > via cPro for Craigslist > iOS: http://tinyurl.com/cPro-iDevice > Android: http://tinyurl.com/

[MBZ] 123 diesel convertible

1978 Mercedes 300cd http://oklahomacity.craigslist.org/cto/6109898561.html via cPro for Craigslist iOS: http://tinyurl.com/cPro-iDevice Android: http://tinyurl.com/CL-Android Sent from my iPhone ___ http://www.okiebenz.com To search list archives http://ww

Re: [MBZ] Bummer For Us

> On May 11, 2017 at 7:12 PM archer75--- via Mercedes > wrote: > > > Has anyone on this list ever actually bought a brand new Mercedes? I think Wilton's got totaled. (Not the one that Max ended up with) Mitch ___ http://www.okiebenz.com To search list arc

Re: [MBZ] Chicago moves up

On Thu, 11 May 2017 07:58:24 -0700 "as.thompson--- via Mercedes" wrote: > Curt, > Not only limit access to a gun but tell you what kind of gun you’re allowed > to own and how much ammunition you can put in each one. As if any of those > restrictions on law-abiding citizens will limit what crim

Re: [MBZ] Bummer For Us

IIRC, Dr. Booth bought his new . . . On Thu, May 11, 2017 at 6:20 PM, OK Don wrote: > My Grandfather bought three new MBs - and my kids and I ended up > owning/driving two of them. Does that count? > > On Thu, May 11, 2017 at 6:12 PM, archer75--- via Mercedes < > mercedes@okiebenz.com> wrote: >

Re: [MBZ] Bummer For Us

My Grandfather bought three new MBs - and my kids and I ended up owning/driving two of them. Does that count? On Thu, May 11, 2017 at 6:12 PM, archer75--- via Mercedes < mercedes@okiebenz.com> wrote: > Has anyone on this list ever actually bought a brand new Mercedes? > The only person I can thin

Re: [MBZ] Bummer For Us

Has anyone on this list ever actually bought a brand new Mercedes? The only person I can think of besides Roger was a young felloww with bipolar disorder who bought one when he was "up" and regretted it when he got back on his meds. He may have been on another list, though. Gerry

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

Yup, I've seen videos of that - water feels hard when you're going fast enough, but if one wheel gets a little low, over you go. On Thu, May 11, 2017 at 5:30 PM, Mitch Haley via Mercedes < mercedes@okiebenz.com> wrote: > > > On May 11, 2017 at 6:07 PM Randy Bennell via Mercedes < > mercedes@okieb

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

> On May 11, 2017 at 6:07 PM Randy Bennell via Mercedes > wrote: > I have to wonder if he was trying to touch his wheels on the truck. Sort > of like the pilots who fly under bridges etc. https://photos.smugmug.com/Other/Pictures2/n-MbxPq/i-8H854qZ/0/e63a3e6d/X2/i-8H854qZ-X2.jpg _

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

That kind of flying is usually done in far more maneuverable aircraft than a light twin. He was probably just too low, making a shallow approach trying to land "on the numbers". Most of my flying has been done from short runways, and I practice short field landings (just under 800' so far in the C

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

Not likely, he'll get counseling and need to get some remedial training, but there's no law against missing the runway :-) On Thu, May 11, 2017 at 5:00 PM, Craig via Mercedes wrote: > On Thu, 11 May 2017 17:04:33 -0400 (EDT) Mitch Haley via Mercedes > wrote: > > > Tore the landing gear off a tw

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

On 11/05/2017 5:00 PM, Craig via Mercedes wrote: On Thu, 11 May 2017 17:04:33 -0400 (EDT) Mitch Haley via Mercedes wrote: Tore the landing gear off a twin engine plane. http://www.livetrucking.com/plane-strikes-semi-on-ohio-highway/ I suspect the pilot might lose his license. Craig ___

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

Much more so - with new ones starting at $500,000, the incentive to keep the old ones flying is pretty high. On Thu, May 11, 2017 at 4:58 PM, Craig via Mercedes wrote: > On Thu, 11 May 2017 16:08:03 -0500 OK Don via Mercedes > wrote: > > > The insurance company will probably total it, but someo

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

On Thu, 11 May 2017 17:04:33 -0400 (EDT) Mitch Haley via Mercedes wrote: > Tore the landing gear off a twin engine plane. > http://www.livetrucking.com/plane-strikes-semi-on-ohio-highway/ I suspect the pilot might lose his license. Craig ___ http://www.okie

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

On Thu, 11 May 2017 16:08:03 -0500 OK Don via Mercedes wrote: > The insurance company will probably total it, but someone will buy it, > repair it, and get it in the air again. Sort of like old cars, huh? Craig ___ http://www.okiebenz.com To search list ar

Re: [MBZ] $1300

All those old rust heaps in your back yard are becoming "classics" and rising in value - you should start getting ready to cash in . . . probably going the way of the W113 . . . On Thu, May 11, 2017 at 4:38 PM, Kaleb C. Striplin via Mercedes < mercedes@okiebenz.com> wrote: > Wow ended at $3750. U

Re: [MBZ] $1300

Wow ended at $3750. Unbelievable. Sent from my iPhone > On May 11, 2017, at 4:17 PM, Randy Bennell via Mercedes > wrote: > > It is interesting how many of the cars on BAT are by flippers. > This seller bought it a month ago. > > RB > > >> On 11/05/2017 4:08 PM, Kaleb C. Striplin via Merced

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

I felt the tug from the tow rope breaking (water skiing rope), then landed as usual. We (the soaring club at OU) had several previous cases of the ring on the end of the rope getting caught on the barbed wire fence between the runway and the highway where the pilot felt the tug, the end of the rope

Re: [MBZ] $1300

It is interesting how many of the cars on BAT are by flippers. This seller bought it a month ago. RB On 11/05/2017 4:08 PM, Kaleb C. Striplin via Mercedes wrote: $2400 Sent from my iPhone On May 11, 2017, at 12:30 PM, Andrew Strasfogel wrote: Someone should try to bid it up to $1805. On

Re: [MBZ] $1300

$2400 Sent from my iPhone > On May 11, 2017, at 12:30 PM, Andrew Strasfogel wrote: > > Someone should try to bid it up to $1805. > >> On Thu, May 11, 2017 at 1:17 PM, Kaleb C. Striplin via Mercedes >> wrote: >> It's just around the corner >> >> Sent from my iPhone >> >> > On May 11, 2017,

Re: [MBZ] Was this the one for Max?

Not my favorite shade of green, but I'd still rather have a green one than fix a fender, bumper, headlight and front suspension on a red one. Mitch. > On May 11, 2017 at 4:24 PM Floyd Thursby via Mercedes > wrote: > > > http://www.ebay.com/itm/182566309819 _

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

The insurance company will probably total it, but someone will buy it, repair it, and get it in the air again. On Thu, May 11, 2017 at 4:03 PM, Craig via Mercedes wrote: > On Thu, 11 May 2017 16:15:04 -0400 Floyd Thursby via Mercedes > wrote: > > > I'm surprised that didn't crash the plane. > >

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

Tore the landing gear off a twin engine plane. http://www.livetrucking.com/plane-strikes-semi-on-ohio-highway/ So, what happened when Don lasso'd a stack? Mitch > On May 11, 2017 at 3:58 PM OK Don via Mercedes wrote: > > > This is even more impressive than snagging a trucks exhaust pipe with

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

On Thu, 11 May 2017 16:15:04 -0400 Floyd Thursby via Mercedes wrote: > I'm surprised that didn't crash the plane. That must have tweeked the airframe significantly! Along with the belly landing, I suspected the plane might be totaled. > Glad the pilot (71) made it safely. Indeed! Craig >

Re: [MBZ] Was this the one for Max?

That's a candidate, it was posted earlier. -- Max Dillon Charleston SC '87 300TD '95 E300 On May 11, 2017 4:24:46 PM EDT, Floyd Thursby via Mercedes wrote: >http://www.ebay.com/itm/1994-Mercedes-Benz-300-Series/182566309819?_trksid=p2047675.c100010.m2109&_trkparms=aid%3D222007%26algo%3DSIC.MBE%

Re: [MBZ] Mercedes Drops Plans to Bring 2017 Diesel Models to US

Well that would be sad I suppose. Being diesel is what sparked my interest in MB in the early '70s in staunch, Detroit iron only Central Illinois. Bob R Sent from my iPhone > On May 11, 2017, at 1:12 PM, Floyd Thursby via Mercedes > wrote: > > I can tell you about it sometime once I learn m

[MBZ] OT OK this is very cool

Not sure what it is good for other than mechanical entertainment https://blog.adafruit.com/2017/05/11/three-strange-reversible-gears-3dthursday-3dprinting/ -- --FT Winston Churchill: “Never give in--never, never, never, never, in nothing great or small, large or petty, never give in except to c

Re: [MBZ] MB parts car going for $52 on fleabay

Yeah, he got the heave from the previous administration after the new guy landed and found himself slaving away in the dreaded private sector! MERKA! --FT On 5/11/17 4:33 PM, Andrew Strasfogel wrote: More likely a corrupt defense contractor skimming off your tax dollars to feed his luxury ca

Re: [MBZ] MB parts car going for $52 on fleabay

More likely a corrupt defense contractor skimming off your tax dollars to feed his luxury car habit, while keeping merika strong.. On Thu, May 11, 2017 at 4:27 PM, Floyd Thursby wrote: > Probably some gummint guy used to spending OPM and figures someone will > give him all the moneys > > --FT >

Re: [MBZ] MB parts car going for $52 on fleabay

Probably some gummint guy used to spending OPM and figures someone will give him all the moneys --FT On 5/11/17 4:26 PM, Andrew Strasfogel wrote: Nice car. judging from the tone of the seller, I bet the reserve is over $4k. On Thu, May 11, 2017 at 4:21 PM, Floyd Thursby via Mercedes mailt

Re: [MBZ] MB parts car going for $52 on fleabay

Nice car. judging from the tone of the seller, I bet the reserve is over $4k. On Thu, May 11, 2017 at 4:21 PM, Floyd Thursby via Mercedes < mercedes@okiebenz.com> wrote: > Andrew this one is linked below it, you should get on it > > http://www.ebay.com/itm/1983-Mercedes-Benz-Other/30231123529 >

[MBZ] Was this the one for Max?

http://www.ebay.com/itm/1994-Mercedes-Benz-300-Series/182566309819?_trksid=p2047675.c100010.m2109&_trkparms=aid%3D222007%26algo%3DSIC.MBE%26ao%3D1%26asc%3D40130%26meid%3De5308d17219d42978229a6d8c7d1ccca%26pid%3D100010%26rk%3D4%26rkt%3D6%26sd%3D302311235297 -- --FT Winston Churchill: “Never give

Re: [MBZ] MB parts car going for $52 on fleabay

Andrew this one is linked below it, you should get on it http://www.ebay.com/itm/1983-Mercedes-Benz-Other/302311235297?_trksid=p2141725.c100338.m3726&_trkparms=aid%3D222007%26algo%3DSIC.MBE%26ao%3D1%26asc%3D20150313114020%26meid%3D30fbe17654154ea2ada100c614a9cbe5%26pid%3D100338%26rk%3D8%26rkt%3D3

Re: [MBZ] MB parts car going for $52 on fleabay

The photos alone are worth $52.00 On Thu, May 11, 2017 at 4:15 PM, Curley McLain via Mercedes < mercedes@okiebenz.com> wrote: > http://www.ebay.com/itm/like/172660622561?ul_noapp=true > > posted here before. > > ___ > http://www.okiebenz.com > > To search list

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

I'm surprised that didn't crash the plane. Glad the pilot (71) made it safely. --FT On 5/11/17 3:58 PM, OK Don via Mercedes wrote: This is even more impressive than snagging a trucks exhaust pipe with a glider tow rope (which I did 1972): http://www.msn.com/en-us/autos/news/trucker-hears-no

[MBZ] MB parts car going for $52 on fleabay

http://www.ebay.com/itm/like/172660622561?ul_noapp=true posted here before. ___ http://www.okiebenz.com To search list archives http://www.okiebenz.com/archive/ To Unsubscribe or change delivery options go to: http://mail.okiebenz.com/mailman/listinfo/merced

Re: [MBZ] 1983 Mercedes 300SD

I like that color though, I might offer $3500 but then I would have to get it from KC --FT On 5/11/17 1:07 PM, Meade Dillon via Mercedes wrote: Through the back window I can see damage to the top of the rear seat (No clear pix of interior other than the instrument cluster). I suspect the int

Re: [MBZ] Mercedes Drops Plans to Bring 2017 Diesel Models to US

I can tell you about it sometime once I learn more about it --FT On 5/11/17 3:53 PM, Dan Penoff via Mercedes wrote: What’s that? -D On May 11, 2017, at 3:51 PM, Floyd Thursby via Mercedes wrote: No, I have been working --FT On 5/11/17 3:50 PM, Dan Penoff via Mercedes wrote: Old news

Re: [MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

On Thu, 11 May 2017 14:58:16 -0500 OK Don via Mercedes wrote: > This is even more impressive than snagging a trucks exhaust pipe with a > glider tow rope (which I did 1972): > > http://www.msn.com/en-us/autos/news/trucker-hears-noise-finds-airplanes-landing-gear-in-his-roof/ar-BBAZEaU?li=BBnbfcL&

[MBZ] OT: Trucker hears noise, finds airplane's landing gear in his roof

This is even more impressive than snagging a trucks exhaust pipe with a glider tow rope (which I did 1972): http://www.msn.com/en-us/autos/news/trucker-hears-noise-finds-airplanes-landing-gear-in-his-roof/ar-BBAZEaU?li=BBnbfcL&ocid=mailsignout -- OK Don *“Travel is fatal to prejudice, bigotry a

Re: [MBZ] Mercedes Drops Plans to Bring 2017 Diesel Models to US

What’s that? -D > On May 11, 2017, at 3:51 PM, Floyd Thursby via Mercedes > wrote: > > No, I have been working > > --FT > > > On 5/11/17 3:50 PM, Dan Penoff via Mercedes wrote: >> Old news. I posted this this morning. You slept in today? >> >> -D >> >> __

Re: [MBZ] Mercedes Drops Plans to Bring 2017 Diesel Models to US

org/cqdjdgtnpvqfrpphfgsdnfkpdtfnhtmtqkmqpqttgljdh_rrrkgnvtvc.html?a=http%3A%2F%2Fwww.autoguide.com%2Fauto-news%2F2017%2F05%2Fmercedes-axes-plans-to-bring-2017-diesel-models-to-us.html&b=Benzworld.org&c=Benzworld.org&d=20170511> *Mercedes Drops Plans to Bring 2017 Diesel Models to US* <http:

Re: [MBZ] Mercedes Drops Plans to Bring 2017 Diesel Models to US

o-news%2F2017%2F05%2Fmercedes-axes-plans-to-bring-2017-diesel-models-to-us.html&b=Benzworld.org&c=Benzworld.org&d=20170511> > > > *Mercedes Drops Plans to Bring 2017 Diesel Models to US* > <http://www.e.benzworld.org/zdrwmbrtpvdkjppzkbcmtkgpmrktzrfrdgfdpdrrblwmr_

[MBZ] Mercedes Drops Plans to Bring 2017 Diesel Models to US

<http://www.e.benzworld.org/cqdjdgtnpvqfrpphfgsdnfkpdtfnhtmtqkmqpqttgljdh_rrrkgnvtvc.html?a=http%3A%2F%2Fwww.autoguide.com%2Fauto-news%2F2017%2F05%2Fmercedes-axes-plans-to-bring-2017-diesel-models-to-us.html&b=Benzworld.org&c=Benzworld.org&d=20170511> *Mercedes Drops P

Re: [MBZ] Chicago moves up

Addison wrote: > It’s getting like Alice In Wonderland out there…. > Addison There's a name we haven't heard from in a while. Tell us more about yerself these days? mao ___ http://www.okiebenz.com To search list archives http://www.okiebenz.com/archive/ To Un

Re: [MBZ] IT HAS BECOME A COLLECTABLE CAR THIS YEAR AND THEREFORE SHOULD BEGIN APPRECIATING IN VALUE WITH TIME.

> On May 10, 2017 at 4:59 PM Craig via Mercedes wrote: > I presume, then, there is no love lost in Indiana for those from the > Chicago area. I always thought that was a SE Wisconsin term. The people from the areas that make Illinois a political cesspool are the ones who can most easily trav

Re: [MBZ] Dang It Again W110

looses. On Thu, May 11, 2017 at 1:31 PM, Dan Penoff via Mercedes < mercedes@okiebenz.com> wrote: > Maybe in your deals. > > -D > > > On May 11, 2017, at 1:08 PM, Kaleb C. Striplin via Mercedes < > mercedes@okiebenz.com> wrote: > > > > You are supposed to let him send you an offer. He who speaks f

Re: [MBZ] Dang It Again W110

Maybe in your deals. -D > On May 11, 2017, at 1:08 PM, Kaleb C. Striplin via Mercedes > wrote: > > You are supposed to let him send you an offer. He who speaks first usually > loses. > > Sent from my iPhone ___ http://www.okiebenz.com To search list ar

Re: [MBZ] $1300

Someone should try to bid it up to $1805. On Thu, May 11, 2017 at 1:17 PM, Kaleb C. Striplin via Mercedes < mercedes@okiebenz.com> wrote: > It's just around the corner > > Sent from my iPhone > > > On May 11, 2017, at 12:16 PM, Dan Penoff via Mercedes < > mercedes@okiebenz.com> wrote: > > > > Chr

Re: [MBZ] Cocaine residue caused the 0 key to stick

I guess if it lacks a front clip that makes it "fair". On Thu, May 11, 2017 at 12:37 PM, Kaleb C. Striplin via Mercedes < mercedes@okiebenz.com> wrote: > Good question > > Sent from my iPhone > > > On May 11, 2017, at 10:50 AM, Andrew Strasfogel > wrote: > > > > If that's "good condition" then w

Re: [MBZ] $1300

It's just around the corner Sent from my iPhone > On May 11, 2017, at 12:16 PM, Dan Penoff via Mercedes > wrote: > > Christmas is coming, too? > > -D > > >> On May 11, 2017, at 1:13 PM, Curt Raymond via Mercedes >> wrote: >> >> Yeah right, heard that before... >> >> From: Kaleb C. S

Re: [MBZ] $1300

Now $1800... Market is HOT! - Max Charleston SC ___ http://www.okiebenz.com To search list archives http://www.okiebenz.com/archive/ To Unsubscribe or change delivery options go to: http://mail.okiebenz.com/mailman/listinfo/mercedes_okiebenz.com

Re: [MBZ] $1300

Christmas is coming, too? -D > On May 11, 2017, at 1:13 PM, Curt Raymond via Mercedes > wrote: > > Yeah right, heard that before... > > From: Kaleb C. Striplin via Mercedes > To: Mercedes Discussion List > Cc: Kaleb C. Striplin > Sent: Thursday, May 11, 2017 1:09 PM > Subject: Re: [

Re: [MBZ] $1300

Wish I would have thought of creating BAT. They got to be raking in the cash Sent from my iPhone > On May 11, 2017, at 12:13 PM, Curt Raymond wrote: > > Yeah right, heard that before... > > > From: Kaleb C. Striplin via Mercedes > To: Mercedes Discussion List > Cc: Kaleb C. Striplin > Sen

Re: [MBZ] $1300

Yeah right, heard that before... From: Kaleb C. Striplin via Mercedes To: Mercedes Discussion List Cc: Kaleb C. Striplin Sent: Thursday, May 11, 2017 1:09 PM Subject: Re: [MBZ] $1300 Soon,  very very soon Sent from my iPhone > On May 11, 2017, at 11:50 AM, Meade Dillon via Merce

Re: [MBZ] $1300

Soon, very very soon Sent from my iPhone > On May 11, 2017, at 11:50 AM, Meade Dillon via Mercedes > wrote: > > $1600 now. > > When will Kaleb start cashing in on BAT > > - > Max > Charleston SC > > On Thu, May 11, 2017 at 9:47 AM, Dan Penoff via Mercedes < > mercedes@okieb

Re: [MBZ] Dang It Again W110

You are supposed to let him send you an offer. He who speaks first usually loses. Sent from my iPhone > On May 11, 2017, at 11:21 AM, Dan Penoff via Mercedes > wrote: > > From what I saw it’s a parking structure of some sort. Not sure if they’re > all there or in other locations. I sent h

Re: [MBZ] 1983 Mercedes 300SD

Through the back window I can see damage to the top of the rear seat (No clear pix of interior other than the instrument cluster). I suspect the interior is less than perfect, so his price is loony. - Max Charleston SC On Thu, May 11, 2017 at 10:19 AM, Craig via Mercedes wrote: > h

Re: [MBZ] $1300

It's up to $1600 with 4 hours to go. I was willing to go $1400 on it. I bet it hits $3k Sent from my iPhone > On May 11, 2017, at 8:47 AM, Dan Penoff via Mercedes > wrote: > > This is a car you buy and just drive it until it dies or rusts away. In > reality it’s not that bad looking of a ca

Re: [MBZ] $1300

$1600 now. When will Kaleb start cashing in on BAT - Max Charleston SC On Thu, May 11, 2017 at 9:47 AM, Dan Penoff via Mercedes < mercedes@okiebenz.com> wrote: > This is a car you buy and just drive it until it dies or rusts away. In > reality it’s not that bad looking of a car

Re: [MBZ] Cocaine residue caused the 0 key to stick

Good question Sent from my iPhone > On May 11, 2017, at 10:50 AM, Andrew Strasfogel wrote: > > If that's "good condition" then what constitutes "fair" or "poor"? > >> On Wed, May 10, 2017 at 10:29 PM, Kaleb Striplin via Mercedes >> wrote: >> Lol >> >> Sent from my iPhone >> >> > On May 10

Re: [MBZ] 1983 Mercedes 300SD

Depends. I’m guessing that’s a clear coat from the color. You can wet sand clear coat, but it’s risky at best to keep from sanding through the finish. As to what it will look like a few months out it’s hard to say. If they didn’t sand through it the finish should be fine. -D > On May 11,

Re: [MBZ] 1983 Mercedes 300SD

You can wet sand and buff the paint on a 1983 benz and it won't look like crap in a few months? Mitch. > On May 11, 2017 at 10:19 AM Craig via Mercedes wrote: > > > https://kansascity.craigslist.org/cto/6078399208.html ___ http://www.okiebenz.com To search

Re: [MBZ] Dang It Again W110

From what I saw it’s a parking structure of some sort. Not sure if they’re all there or in other locations. I sent him an email with an offer last night. No word as of this moment. I’m hoping to hear back from him soon… -D > On May 11, 2017, at 12:17 PM, Andrew Strasfogel via Mercedes >

Re: [MBZ] Bummer For Us

No doubt some on our list are into a new vehicle costing north of $40k, but considering the traffic today with links to all these 30 year old relics I found the juxtaposition amusing... On Thu, May 11, 2017 at 12:15 PM, Dan Penoff via Mercedes < mercedes@okiebenz.com> wrote: > I think there are a

Re: [MBZ] Bummer For Us

We need those people who need a new car to impress their neighbors to buy them so we can get them for pennies on the dollar when they're older. Someone needs to keep the supply of used MBs coming . . . On Thu, May 11, 2017 at 11:13 AM, Andrew Strasfogel via Mercedes < mercedes@okiebenz.com> wrote:

Re: [MBZ] Dang It Again W110

And for whoever is still in the running, I'm willing to visit the yard where the 200D and dozens of other veteran Benzes are allegedly being kept. On Thu, May 11, 2017 at 11:32 AM, Ed Booher via Mercedes < mercedes@okiebenz.com> wrote: > I have AC. It isn't *in* the car. But I have AC. By the way

Re: [MBZ] Bummer For Us

I think there are a few members who have considered new or late model cars, so there’s some relevance to this. That and the ongoing issue of “diesel or not” by car manufacturers selling in the US. -D > On May 11, 2017, at 12:13 PM, Andrew Strasfogel via Mercedes > wrote: > > Sure - many in

Re: [MBZ] 1983 Mercedes 300SD

DON'T MAKE ME REDUCE A THIRD TIME OR I'LL HOLD MY BREATH UNTIL I TURN BLUE! On Thu, May 11, 2017 at 10:43 AM, Rick Knoble via Mercedes < mercedes@okiebenz.com> wrote: > Craig inquires: > > >‎What do you folks think of this one? > > Still needs routine maintenance items addressed. > Fluids-all > F

Re: [MBZ] Bummer For Us

Sure - many in our enthusiast group would have jumped at the chance to snag a NEW $50,000 Mercedes diesel to show off to the neighbors. ;) On Thu, May 11, 2017 at 10:09 AM, Dan Penoff via Mercedes < mercedes@okiebenz.com> wrote: > http://www.autoguide.com/auto-news/2017/05/mercedes-axes- > plans

Re: [MBZ] TD tail lights

I have a couple spare taillight lenses but could use a pair of matching front turn signal lenses for my123 wagon and a couple reverse light lenses. Or am I too late?. On Thu, May 11, 2017 at 9:57 AM, Karl Wittnebel via Mercedes < mercedes@okiebenz.com> wrote: > The 124 versions are about 100 for

Re: [MBZ] 1987 Mercedes-Benz 300SDL

"The best way to describe this is... WET" On Thu, May 11, 2017 at 9:37 AM, Kaleb Striplin via Mercedes < mercedes@okiebenz.com> wrote: > I wouldn't think so > > Sent from my iPhone > > > On May 11, 2017, at 8:03 AM, Dan Penoff via Mercedes < > mercedes@okiebenz.com> wrote: > > > > Uh, yeah, I do

Re: [MBZ] This Looks Nice

Ditto on the color - rot brun. I think that may be the last year it was available. Is that Winchester, VA? On Thu, May 11, 2017 at 8:49 AM, Dan Penoff via Mercedes < mercedes@okiebenz.com> wrote: > True, but I love the color. It looks to be pretty straight. Hagerty puts > a #3 240D of the sam

Re: [MBZ] Insane bidding on an '84 300TD on BAT

My ex spouse used to call that slightly brighter than OEM color "motorcycle blue". Any predictions on this one? On Wed, May 10, 2017 at 10:40 PM, clay via Mercedes wrote: > http://bringatrailer.com/listing/1985-mercedes-benz- > 230ce-european-grey-market/ > > this one is near me, but I do not w

Re: [MBZ] Cocaine residue caused the 0 key to stick

If that's "good condition" then what constitutes "fair" or "poor"? On Wed, May 10, 2017 at 10:29 PM, Kaleb Striplin via Mercedes < mercedes@okiebenz.com> wrote: > Lol > > Sent from my iPhone > > > On May 10, 2017, at 9:21 PM, Craig via Mercedes > wrote: > > > > On Wed, 10 May 2017 19:59:13 -0500

  1   2   >