sahasranaman wrote:
Use 2.0 / 3 * 100 to solve this. Why make things look bigger?
you mean that
a.0 / 3 * 100
works in your Python version? that's interesting.
(maybe you should at least skim the the thread before you jump in?)
--
http://mail.python.org/mailman/listinfo/python-list
Anish Chapagain wrote:
hi thank's i probably missed the b.pack() but it's till the window is
not closed and error message of Windows Appear
what does that error message say?
--
http://mail.python.org/mailman/listinfo/python-list
lookon wrote:
I am new to python and had difficulty in installing simplejson on
WinXP...Could anyone help me? Thanks
what did you try, and what happened when you tried that?
--
http://mail.python.org/mailman/listinfo/python-list
Anish Chapagain wrote:
from Tkinter import *
root=Tk()
f=Frame(root,height=200,width=200)
b=Button(f,text="quit",command=f.quit)
f.pack()
root.mainloop()
--
from Tkinter import *
import sys
root=Tk()
f=Frame(root,height=200,width=200)
b=Button(f,t
Alexandru Palade wrote:
However, you should be carefully because using an %i modifier for a
what-should-be a float value truncates the value in a way you may not
expect.
What I mean is that if you have sent 2 out of 3 bytes, the math will be
200/3 which with the %i modifier will print 66, rathe
Jeff wrote:
throw KeyError('%s not found' % str(val))
"throw"? and shouldn't that be a ValueError? ;-)
--
http://mail.python.org/mailman/listinfo/python-list
skazhy wrote:
hi, i am new to python, so i've a really simple question about
dictionaries.
if i have a dictionary and I make have an input after it (to input
numbers) can i get the key of value that was in input?
A dictionary contains (key, value) pairs, and is optimized for quickly
finding t
Jie wrote:
i'm having trouble executing os.system('source .bashrc') command
within python, it always says that source not found and stuff. Any
clue?
like in
$ python
>>> import os
>>> os.system("source .bashrc")
sh: source not found and stuff
256
? I get
$ python
oj wrote:
Fine, this works, although match instead of search blah blah blah as
has already been mentioned. I still think searching for one invalid
character is more elegant then trying to match the entire string, but
that's just personal preference, I guess.
The drawback is that it's a lot eas
[EMAIL PROTECTED] wrote:
2.6 is meant to be a continuation of the 2.x line of Python, to
support a gradual move of larger projects over to the Python 3.x
series.
note that Python also has a tradition of releasing X.6 and (X+1).0 at
the same time:
http://mail.python.org/pipermail/python-anno
Robert Rawlins wrote:
I’ve got what seems to me to be a totally illogical math issue here
which I can’t figure out. Take a look at the following code:
/self/.__logger.info(/"%i / %i"/ % (bytes_transferred,
/self/.__sessions[path].total_bytes))
percentage = bytes_transferred
Perhaps you could explain what you mean by "$ does the right thing".
wtf is wrong with you?
(I mean, you do know under what circumstances $ matches a newline
character when used without modifiers, right? So why do you keep
behaving like a reddit commenter?)
--
http://mail.python.org/mai
David Bikard wrote:
I'd like to run a program so that it reads the input() or raw_input()
statements from an input file instead of
reading from keyboard. I'd also like it to write the print statements in
an output file rather than on the screen.
I'm on windows XP and when I run:
>
prog_nam
James Tanis wrote:
there's also apache, of course, and a bunch of others, including several
Python solutions (more or less pre-packaged). but the "open up" part
still sounds a bit risky. maybe you could turn things around, and let
the application "push" data to your server instead?
Either
Michael Torrie wrote:
[EMAIL PROTECTED] wrote:
I'm not dissing Python, here. Just noting that, if it is written in C,
that throws a curve at me in trying to balance the value of learning
Python vs. some other major language.
Definitely one of the most non-sequitor statements I have ever hea
John Machin wrote:
'\n' is an "other character".
so how does a user enter that character?
Perhaps you could explain what you mean by "$ does the right thing".
wtf is wrong with you?
--
http://mail.python.org/mailman/listinfo/python-list
[EMAIL PROTECTED] wrote:
Thanks, Fredrik - that definitely works. Now to get a little greedy -
is there something along those lines that is a bit more secure (i.e.
allows HTTPS, possibly with authentication)? Basically something that
you would feel more comfortable opening up to the Internet..
Kless wrote:
I could use the next but I don't think...
---
def __check(self, **keywords):
---
don't think what?
if you keep using the same variables in all submethods you call from a
method inside the class, why not make them attributes?
otherwise, using the **
[EMAIL PROTECTED] wrote:
As part of a Python app I wrote recently (for Windows), I would like
to give the option of an HTTP (HTTPS if possible, but not necessary)
front end, which would then call some existing python scripts. My
question is - I know I can write a simple HTTP server in Python, b
John Machin wrote:
try "[LRM]+$" (an L or an R or an M, one or more times, all the way to
the end of the string).
Ummm ... with the default flag settings, shouldn't that be \Z instead
of $ ?
Why? The OP was reading input from a user; whether he gets a trailing
newline or not depends on the
Michael Tobis wrote:
I realize that lambda is something of an orphan and was arguably a bad
idea for anything besides obfuscation, but obfuscation is exactly my
purpose here. Can a lambda call itself without giving itself a name?
Google was not my friend on this one, and I suspect there is no
an
David Lyon wrote:
But is the question about display graphics ?
ie rotating a cube using a python framework ?
With something like python and OpenGL ? or Python and PovRay... or
perphaps python and imagemagick ?
can you name one graphics framework that represents a cube as "x + 4*y +
16*z" ?
Gerth, William D wrote:
Hey all, I’m simply trying to get my feet wet with XML parsing, and I
tried to just do something simple with ElementTree, just throw the XML
tags from a file into a list. The code is as follows (and may be wrong):
...
xml.parsers.expat.ExpatError: no element found:
Mr SZ wrote:
I am taking a string as an input from the user and it should only
contain the chars:L , M or R
I tried the folllowing in kodos but they are still not perfect:
[^A-K,^N-Q,^S-Z,^0-9]
[L][M][R]
[LRM]?L?[LRM]? etc but they do not exactly meet what I need.
>
For eg: LRLRLRLRLM is ok
> they have an official API, you know:
>
> http://developer.yahoo.com/search/boss/
and yes, there are other options too, including pYsearch which is
available from their developer network:
http://developer.yahoo.com/python/python-pysearch.html
for more Python stuff from/for Yahoo, see
spandana g wrote:
HTTPError: HTTP Error 999: Unable to process request at this time --
error 999
Previously i got the error which I have attached below when I use just
urlopen . But now when I use this http request
user_agent='Mozilla/3.0(compatible;MISE 5.5;Windows NT)'
headers={'User-Agen
Frank Millman wrote:
> I thought that the main point of using property was to prevent direct
> access to the attribute.
Not "prevent access to" as much as "add behaviour to".
Is this a valid comment, or does it come under the category of 'we are
all adults here'?
The latter. And the "__" do
Alexnb wrote:
"hello"[0]
'h'
"hello"[0] == "<"
False
"hello"[0] == "h"
True
"hello".startswith("h")
True
really? That's just like C. I thought that it would fail because of the way
lists work. Thanks!
what way?
the first three will fail if the string is empty.
>>> ""[0]
Tra
Julien wrote:
I can't seem to find the right regular expression to achieve what I
want. I'd like to remove all characters from a string that are not
numbers, letters or underscores.
For example:
magic_function('[EMAIL PROTECTED]')
str: 'si_98udasgf'
the easiest way is to replace the things
Stefan Scholl wrote:
And by the way: The quote was changed by deleting something on
the same line:
"June 2008 is a bit too early. Django isn't ready."
vs.
"Django isn't ready."
Is this a language issue? That you meant to write "django 1.0 isn't
done" (as in
Stefan Scholl wrote:
Django isn't ready.
That's a remarkably ignorant statement.
The 1.0 release will be in September.
So? "1.0" will be done then, yes. In what way does that mean that
Django itself isn't ready, in any sane sense of that word?
(For bystanders, Django's 0.91 release in
J-Burns wrote:
Is there a built in Python function for this?
for answering questions that have nothing to do with programming, and
looks quite a bit like homework? don't think they've added that one yet.
maybe you should look for a geometry newsgroup/forum?
--
http://mail.python.org/mai
Fredrik Lundh wrote:
> Do these objects have direct references to a resource that you're
> explicitly destroying from your C code?
and yes, if this is the problem, the correct solution is to create an
separate object type that's designed to manages the resource and act as
a
Kyle Lanclos wrote:
The DECREF decrements the reference count, but does not immediately prompt
garbage collection when the reference count drops to zero; that garbage
collection does not appear to occur until I return from the particular C
function I am in the middle of executing.
Yeah, but wh
Kyle Lanclos wrote:
I want to modify the above sequence to manually prompt Python's garbage
collection routine(s) to take over (performance is not an issue here),
similar to the following:
Py_XDECREF (some_callback);
PyCollect_Garbage ();
closeService (some_service);
return;
Is that possible?
Peng Yu wrote:
Perl has a command line help perldoc. I'm wondering if python has a
similar help command.
it's built into the interpreter, and Python tells you how to use it when
you start Python in interactive mode.
$ python
Python 2.5.1
Type "help", "copyright", "credits" or "license" for
John S wrote:
> Not sure why you picked \A and \Z -- they are only useful if you are
> using the re.M flag.
Well, they're aliases for ^ and $ in "normal" mode, at least for strings
that don't end with a newline.
re.I is the same as re.IGNORECASE. More than one option may be OR'ed
together. T
[EMAIL PROTECTED] wrote:
This script uses a simple for loop to zip some files. However I am
repeating code that cries out for a nested loop.
Cries out for a *function*, I'd say.
My two lists of files_to_be_zipped (spare and seekfacts) are of
> uneven length so I can't seem to decipher the "
Peng Yu wrote:
I didn't read the docs and tried the following code.
regex = re.compile(r"\A" + re.escape(old_str) + r"\Z",
opts.ignore_case and re.I or 0)
But I'm not sure why it is not working.
as the documentation says, \A and \Z matches at the beginning/end of a
*string*, not a word.
Keith Hughitt wrote:
I am using someone else's script which expects input in the form of:
./script.py arg2
is a common notation for "replace with argument value", so it
could be that they're just expecting you to type:
./script.py arg1 arg2
Alternatively, they meant
./scri
Ben Sizer wrote:
make my development a lot easier.
Knowing what kind of development you do might help, of course. Some
libraries are excellent in some contexts and suck badly in others...
Looking at things that larger projects and distributions use can also be
a good idea. For example, i
Beema shafreen wrote:
How do I write a regular expression for this kind of sequences
>gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE
line.split("|") ?
it's a bit hard to come up with a working RE with only
Tim Golden wrote:
This is included in the latest pywin32-211 as well:
import win32process
print win32process.IsWow64Process ()
on the other hand, "ctypes" is only an import away if you have a current
Python...
--
http://mail.python.org/mailman/listinfo/python-list
Ken Hartling wrote:
> Thanks .. but I want to find out if the system is "running on 64bit"
> even when the interpreter is a 32-bit build executable ("what python
> was built on"). platform.architecture() and platform() in general
> seems to only be looking at the build executable
You can pass i
Jeff wrote:
Is this avoidable by using a call to list() in the definition instead?
No. Default values are *always* evaluated when, and only when, the
"def" statement is executed; see:
http://docs.python.org/ref/function.html
Also note that "def" is an executable statement in Python, a
Andreas Tawn wrote:
I don't have experience of too many other languages, but in C++ (and I
guess C)...
That's invalid C (you cannot declare variables in the "for" statement
itself, at least not in C89). And back in the old days, some C++
compilers did in fact leak declarations from "for" lo
Robert Rawlins wrote:
What’s the simplest way to access a classes namespace from within
itself. I want to use it in a custom __repr__() method so it prints the
current namespace for the class like package.module.class.
Name or namespace? You can access the class name from an instance via
th
Andreas Tawn wrote:
I never knew that and I can't find reference to it in the docs.
the for-in loop does ordinary assignments in the current scope:
http://docs.python.org/ref/for.html
"Each item in turn is assigned to the target list using the
standard rules for assignments, and
Alexnb wrote:
e = ''
try:
...
except HTTPError, e:
print e.code
except URLError, e:
print e.reason
if e == '':
print "good to go"
footnote: here's a better way to test if an exception was raised or not:
try:
...
except HTTPError, e:
print e.co
Stefan Scholl wrote:
Django isn't ready.
That's a remarkably ignorant statement.
--
http://mail.python.org/mailman/listinfo/python-list
Mark McDuff wrote:
I'm trying to read one byte from stdin, without the newline.
If I try something like:
>>> import os, sys
>>> os.read(sys.stdin.fileno(),1)
I can input a character, but then I have to press enter, which leaves a
newline character in the stdin buffer and requires two keypre
ZelluX wrote:
I want to write a script which will rename PDFs according to their
titles. I want to know if there is any library that can extract
titles(the first line of the PDF) from PDFs.
Mathieu Fenniak's PyPdf should be able to do this:
http://pybrary.net/pyPdf/
(but note that "the f
Bruce Pearson wrote:
The first call to test has the file_list empty but on the second call to
test the file_list is no longer empty but contains the values appended
in the first call.
Is this correct behavior? I'm using python 2.5
yes:
http://docs.python.org/ref/function.html
"Def
Joshua Kugler wrote:
Experimenting has shown me that re.findall() will return a list with the
matches in the order it found them.
"in the order it found them" doesn't really say much, does it? ;-)
"findall" and "finditer" both scans the string from left to right, and
will return matches in t
Jerry Hill wrote:
This is just plain untrue. If 'name is None' evaluates to true, then
the variable 'name' is bound to the singleton value None. It has
nothing to do with allocated memory or null pointers. All it means is
that someplace along the line you did the equivalent of 'name = None'
i
Victor Noagbodji wrote:
Well that's exactly why I'm asking. Since None returns False in if
statements. Why do people use if name is not None: instead of simply
writing if not name?
Because they want to distinguish between None and other values that
evaluate to False, of course. As the page I
Victor Noagbodji wrote:
what's the difference between these two statement?
one checks if the given object is not None, the other checks if it's a
true value:
http://docs.python.org/ref/Booleans.html#Booleans
> And which one should one use?
depends on what you want to test for, of cour
Robert Rawlins wrote:
I then get the following exception thrown when running my code:
When the application is running, or when it is shutting down?
Traceback (most recent call last):
File "/usr/lib/python2.5/logging/handlers.py", line 73, in emit
if self.shouldRollover(record):
File
ssecorp wrote:
def append(self, item):
self.stack.append(item)
I can get to see the stack with var.stack but then why even implement
append when I could do self.stack.append(x) etc.
That way you could do away with OO completely.
Umm. Even if you were to write that, self and stack
goldtech wrote:
I would be grateful for support with the code I cited. It's not long
and fairly standard. I'm sure my error(s) would be glaring to more
experienced coders. I appreciated the "heads-up" about other options
but I would be grateful for help getting this code to run. Thanks
For com
greg wrote:
I am able to use the PIL module to capture a screen or specific
window. My problem is when capturing a window (on windows XP) I can
only capture the "visible" portion of the window. Is there any way to
capture the entire window? specifically the scrolled portion of a
window that i
Stefan Behnel wrote:
>> Is there a simpler way to read the iTunes XML? (It's merely a plist,
>> so the format is much simpler than general XML.)
>
> Try lxml. Since version 2.0, its parsers will not access the network unless
> you tell it to do so.
>
> http://codespeak.net/lxml
which makes it t
[EMAIL PROTECTED] wrote:
> a good thing about python is the portability though. but u cant make
> an exe that can be used on mac too, ie one exe fpr both?
you can create a portable python archive, but EXE files are windows only.
> if i want to make an exe for mac, what do i need?
see the second
[EMAIL PROTECTED] wrote:
> how do you create exe-files of your python-code?
>
> is it different depending on what libraries, GUI-frameworks you use?
>
> i want to create an exe-file of a pythonscript that uses Tkinter.
assuming windows only, you want:
http://www.py2exe.org/
also see:
http://
kj7ny wrote:
> With some of my larger applications, it doesn't seem to work well to
> try to run the whole thing in the interpreter. At least for me, I am
> not a big IDE sort of programmer. I am much more comfortable in vim
> and command line stuff. I suppose I should use the IDE more.
you do
Steve Holden wrote:
>> for reference, here's what I get on Ubuntu 7.10, with the standard
>> Python interpreter (2.5.1):
>>
>> $ python -c "import imp; print imp.get_suffixes()"
>> [('.so', 'rb', 3), ('module.so', 'rb', 3), ('.py', 'U', 1),
>> ('.pyc', 'rb', 2)]
>>
>> any Ubuntu gurus here that c
[EMAIL PROTECTED] wrote:
> i dont know, i used a piece of code i found which had a createwidgets-
> method. isnt init a function, not a method btw(or it is the same
> thing?)
a method is a function defined inside a class statement, and which is
designed to be called via an instance of that class
Fredrik Lundh wrote:
> and for the record, Python doesn't look for PYD files on any of the Unix
> boxes I have convenient access to right now. what Ubuntu version are
> you using, what Python version do you have, and what does
>
> $ python -c "import im
[EMAIL PROTECTED] wrote:
>> def __init__(self):
>> # ...
>> button = Button(self,
>> text='1',
>> command=lambda n=1: self.display(n))
>> # ...
>>
>> def display(self, number):
>> print number
>
> should this
[EMAIL PROTECTED] wrote:
> Thanks it sorted out my 'StringVar' problem.
> I now have another problem...
>
> Exception in Tkinter callback
> Traceback (most recent call last):
> File "D:\Python24\lib\lib-tk\Tkinter.py", line 1345, in __call__
> return self.func(*args)
> TypeError: Insert() t
Francesco Bochicchio wrote:
> It should be added here that in Python you have several ways get around
> this Tkinter limitation and pass an user argument to the callback. Once
> upon a time , back in Python 1.x, I used to do something like this:
>
> class CallIt:
> def __init__(self, f, *a
llothar wrote:
> I don't think so. I asked a pretty simple question and as usual on
> usenet nobody read the question
did *you* read your own question? it took you three posts before you
mentioned what you were trying to do, and four posts before you bothered
to mention that you're seeing this
Steve Holden wrote:
> You display your ignorance here. The ".pyd" extension is used on Windows
> as an alternative to ".dll", but both are recognized as shared
> libraries. Personally I'm not really sure why they even chose to use
> ".pyd", which is confusing to most Windows users. In UNIX/Linu
[EMAIL PROTECTED] wrote:
> Traceback (most recent call last):
> File "F:\Programming\python and database\access_db8.2.py", line 129,
> in ?
> Tkwindow()
> File "F:\Programming\python and database\access_db8.2.py", line 88,
> in Tkwindow
> title = stringVar()
> NameError: global name 's
[EMAIL PROTECTED] wrote:
> I can fetch records but cannot insert records.
>
> def Insert(self, *row):
> global cursor, title, author, pubdate
using globals to pass arguments to a function/method is usually not a
good idea. any reason you cannot pass them in as arguments?
> sqlInsert =
llothar wrote:
> I ship an application that compiles an python interpreter and
> extension on a remote system.
> It also needs to copy this created items around. So if i use setup.py
> to create an
> extension i need to know the file name of the generated file.
so why not just ask setup.py
llothar wrote:
> My question was: Why does setup.py generated sometimes a pyd and
> sometimes a so file?
setup.py picks an extension that happens to work on the platform you're
running setup.py on. doing otherwise would be pretty pointless.
--
http://mail.python.org/mailman/listinfo/python-
[EMAIL PROTECTED] wrote:
> Is there any way in python to say
>
> if string1 in string2:
>
>
> ignoring the case of string1 and string2?
if string1.lower() in string2.lower():
...
(there's no case-insensitive version of the "in" operator in stock Python)
--
http:
kj7ny wrote:
> For years it has been a slight annoyance that every time I wanted to
> test a snippet of code from a class by running it in the interactive
> interpreter, I had to remove all of the self. instances from the
> code. After I got it working correctly, I had to put all the self.'s
> ba
George Sakkis wrote:
>> If it was a bug it has to violate a functional requirement. I can't
>> see which one.
>
> Perhaps it's not a functional requirement but it came up as a real
> problem on a source colorizer I use. I count on newlines generating
> token.NEWLINE or tokenize.NL tokens in order
llothar wrote:
> On windows everything is '.pyd' but there seems to be two ways to get
> this on unix?
If you attempt to import the module "spam" on Windows, Python looks for
"spam.dll" and "spam.pyd" (in addition to "spam.py/spam.pyw/spam.pyc" etc)
On most Unix platforms, Python looks for "spa
erikcw wrote:
> I'm parsing real-world HTML with BeautifulSoup and XML with
> cElementTree.
>
> I'm guessing that the only benefit to using ElementSoup is that I'll
> have one less API to keep track of, right? Or are there memory
> benefits in converting the Soup object to an ElementTree?
It's
Raj kumar wrote:
> document.createElement("abc")
> and i appeneded it by using append() method.
> But how i can reflect this change to my xml file?
write it out again:
http://python.org/doc/current/lib/dom-objects.html
--
http://mail.python.org/mailman/listinfo/python-list
globophobe wrote:
> In [1]: unicode_html = u'\u3055\u3080\u3044\uff0f\r\n\u3064\u3081\u305f
> \u3044\r\n'
>
> I need to turn this into an elementtree, but some of the data is
> japanese whereas the rest is html. This string contains a .
where? is an element, not a character. "\r" and "\n" are
Arian Sanusi wrote:
> concerning to unicode, "\n", "\r "and "\r\n" (0x000A, 0x000D and
0x000D+0x000A) should be threatened as newline character
the link says that your application should treat them line terminators,
not that they should all be equal to a new line character.
to split on Unicode
Martey wrote:
> I am trying to use imaplib to download messages, but I keep getting
> memory errors when I try to download a large message (i.e. one with
> attachments). Here is my test code (similar to the example in the
> imaplib documentation):
> /.../
> I am using Mac OS X 10.5 and Python 2
Lamonte Harris wrote:
> Okay I've created a script and basically when I loop through a folder it
> is supposed to change the Label everytime it updates a file then again
> it doesn't do nothing but shows the last file edited, whats the best way
> to loop through files and display that file name
John Machin wrote:
> I'm happy enough with reassembling the second item. The problem is in
> reliably and correctly collapsing the whitespace in each of the above
> fiveelements. The standard Python idiom of u' '.join(text.split())
> won't work because the text is Unicode and u'\xa0' is whitesp
Zbigniew Braniecki wrote:
> It's really a nice pitfall, I can hardly imagine anyone expecting this,
> or how easily could I find this info (e.g. what query should I give to
> google to get it without bothering people on this group)
looking things up in the documentation *before* deciding that y
Peter Bengtsson wrote:
> root = Element('feed', xmlns='http://www.w3.org/2005/Atom')
> root.set('xmlns:se', NS_URL)
> entry = SubElement(root, 'entry')
> SubElement(root, 'title').text = 'Title'
> SubElement(entry, SEN('category')).text = 'Category'
> But surely the xmlns:se attribute on the tag
[EMAIL PROTECTED] wrote:
> """
>
> time.clock() isn't high enough resolution for Ubuntu, and time.time()
> isn't > high enough resolution on windows.
>
> Take a look at datetime. It is good to the micro-second on Linux and
> milli-second on Windows.
datetime.datetime.now() does the same thing
John Machin wrote:
> AFAICT that was enough indication for most people to use time.clock on
> all platforms ...
which was unfortunate, given that time.clock() isn't even a proper clock
on most Unix systems; it's a low-resolution sample counter that can
happily assign all time to a process that
j igisbert.etra-id wrote:
> this. I have download Imaging-1.1.6 source code, and I found PIL folder,
> but not binary file. If I download windows exe installer, it works
> great, but I want to install manually for installing it on my PDA
as the name implies, the source code distribution co
thebjorn wrote:
> Eh...
oh, forgot that it was "pulling requirements out of thin air" week on
c.l.python.
> def chop(lst, length):
> n = len(lst) / length
> z = [lst[i:i+n] for i in xrange(0, len(lst), n)]
> if len(z[-1]) < n and len(z) > 1:
> z[-2].extend(z.pop(-1))
>
Erik Lind wrote:
> I'm new to Python, and OOP. I've read most of Mark Lutz's book and more
> online and can write simple modules, but I still don't get when __init__
> needs to be used as opposed to creating a class instance by assignment.
nothing is ever created by plain assignment in Python;
Jeroen Ruigrok van der Werven wrote:
> I personally tend to see __init__ or __new__ as equivalent to what other
> languages call a constructor.
>
> (And I am sure some people might disagree with that. ;))
given that they do different things, I'm not sure it's that helpful to
describe them *both
lotrpy wrote:
> key = int(itemgetter(0)) is wrong, key = lambda x:int(x[0]) works.
> but s.b. told me itemgetter execute more quickly .
so you're more interested in speed than in correctness? ;-)
operator.itemgetter is a function factory that creates a *function* that
fetches the given item fr
Martin Marcher wrote:
> I can see that sqlite is in the standard lib documentation:
> http://docs.python.org/lib/module-sqlite3.html
>
> however debian and ubuntu (and gentoo according to the packages info) seem
> _not_ to include it.
http://packages.debian.org/python-sqlite
--
http://mail.
mikez302 wrote:
> I opened a command window in my Python25 folder and tried typing
> pythonw. I just got another command prompt as if the program ran but
> didn't do anything. It looked like this:
>
> C:\Python25>pythonw
>
> C:\Python25>
"pythonw" is the console-less version of the Python run
marcstuart wrote:
> How do I divide a list into a set group of sublist's- if the list is
> not evenly dividable ? consider this example:
>
> x = [1,2,3,4,5,6,7,8,9,10]
> y = 3 # number of lists I want to break x into
> z = y/x
>
> what I would like to get is 3 sublists
>
> print z[0] = [1
401 - 500 of 4900 matches
Mail list logo
