On 2021-04-06 02:32 PM, Bill Cole wrote:
PLEASE NOTE:

I read the mailing list obsessively and DO NOT NEED (or want) the
extra copies sent when you send both to me and to the list.

Sorry, I still haven't figured out how to properly respond. When I hi "reply all" it cc's the list and sends to you. When I hit just "reply" it only sends to you. I've manually deleted you from the "To" box and sending it directly to the list here. Hopefully that fixes things up.

Since the scores being added during delivery are much richer,
detecting enough info to do SPF and DKIM analysis, I am 99.9% certain
that the format of 'some_email' is mangled, probably missing critical
headers or using CR linebreaks instead of proper LFs.

Hmm, this is on a linux box, so I'm not sure how it could be screwing up the line breaks. Is it possible that when spamd injects the scores before the body of the email, it is screwing things up?

Here is email as it sits in my inbox now, which is after it gets processed by spamd. I was under the impression that an email that had already been processed by SA could be processed again and it would ignore any modifications made by earlier passes through SA.

Return-Path: <bounce-use=m=44682734836=echo4=6df0a8c162cdc2810dc8b4fe0a119...@returnpath.bluehornet.com>
Delivered-To: s...@exmaple.com
Received: from email.exmaple.com
        by email.exmaple.com with LMTP
        id kAhSKc1dY2BCKgAAB604Gw
(envelope-from <bounce-use=m=44682734836=echo4=6df0a8c162cdc2810dc8b4fe0a119...@returnpath.bluehornet.com>)
        for <s...@exmaple.com>; Tue, 30 Mar 2021 13:20:13 -0400
Received: by email.exmaple.com (Postfix, from userid 115)
        id A64BE200C8; Tue, 30 Mar 2021 13:20:13 -0400 (EDT)
Received: from localhost by email.exmaple.com
        with SpamAssassin (version 3.4.2);
        Tue, 30 Mar 2021 13:20:13 -0400
From: "Home Warranty - AHS" <s...@forgetmassives.com>
To: <steveexma...@comcast.net>
Subject: *****SPAM***** It's getting warmer, are you covered?
Date: Tue, 30 Mar 2021 05:18:34 -0700
Message-Id: <B3.BE.10603.49D53606@emsmta18>
X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on email.exmaple.com
X-Spam-Flag: YES
X-Spam-Level: *****
X-Spam-Status: Yes, score=5.2 required=5.0 tests=BAYES_99,BAYES_999,
        DATE_IN_PAST_03_06,DKIM_SIGNED,DKIM_VALID,DKIM_VALID_AU,
HTML_IMAGE_RATIO_02,HTML_MESSAGE,RCVD_IN_DNSWL_LOW,RCVD_IN_MSPIKE_H2,
        SPF_HELO_NONE,SPF_SOFTFAIL shortcircuit=no autolearn=no
        autolearn_force=no version=3.4.2
MIME-Version: 1.0
Content-Type: multipart/mixed; boundary="----------=_60635DCD.A0F5D194"

This is a multi-part message in MIME format.

------------=_60635DCD.A0F5D194
Content-Type: text/plain; charset=iso-8859-1
Content-Disposition: inline
Content-Transfer-Encoding: 8bit

Spam detection software, running on the system "email.exmaple.com",
has identified this incoming email as possible spam.  The original
message has been attached to this so you can view it or label
similar future email.  If you have any questions, see
the administrator of that system for details.

Content preview: Your AHS Home Warranty covers the repair or replacement of many system and appliance breakdowns, but not necessarily the entire system or appliance. Please refer to your contract for details. American Home Shield 150 Peabody Pl., Memphis, TN 38103. Unsubscribe | Privacy Policy © 2021
  American Home Shield Corporation. All rights reserved.

Content analysis details:   (5.2 points, 5.0 required)

 pts rule name              description
---- ---------------------- --------------------------------------------------
 0.2 BAYES_999              BODY: Bayes spam probability is 99.9 to 100%
                            [score: 1.0000]
 3.5 BAYES_99               BODY: Bayes spam probability is 99 to 100%
                            [score: 1.0000]
0.7 SPF_SOFTFAIL SPF: sender does not match SPF record (softfail) -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at https://www.dnswl.org/,
                            low trust
                            [69.252.207.38 listed in list.dnswl.org]
-0.0 RCVD_IN_MSPIKE_H2      RBL: Average reputation (+2)
                            [69.252.207.38 listed in wl.mailspike.net]
 1.6 DATE_IN_PAST_03_06     Date: is 3 to 6 hours before Received: date
 0.0 SPF_HELO_NONE          SPF: HELO does not publish an SPF Record
 0.0 HTML_IMAGE_RATIO_02    BODY: HTML has a low ratio of text to image
                            area
 0.0 HTML_MESSAGE           BODY: HTML included in message
-0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from
                            author's domain
-0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily
                            valid

The original message was not completely plain text, and may be unsafe to
open with some email clients; in particular, it may contain a virus,
or confirm that your address can receive spam.  If you wish to view
it, it may be safer to save it to a file and open it with an editor.


------------=_60635DCD.A0F5D194
Content-Type: message/rfc822; x-spam-type=original
Content-Description: original message before SpamAssassin
Content-Disposition: attachment
Content-Transfer-Encoding: 8bit

Received-SPF: Softfail (mailfrom) identity=mailfrom; client-ip=69.252.207.38; helo=resqmta-ch2-06v.sys.comcast.net; envelope-from=bounce-use=m=44682734836=echo4=6df0a8c162cdc2810dc8b4fe0a119...@returnpath.bluehornet.com; receiver=<UNKNOWN>
Authentication-Results: email.exmaple.com;
dkim=pass (2048-bit key; secure) header.d=comcastmailservice.net header.i=@comcastmailservice.net header.b="YTHf56Fx"; dkim=pass (1024-bit key; unprotected) header.d=forgetmassives.com header.i=@forgetmassives.com header.b="Cc3SOvHE";
        dkim-atps=neutral
Received: from resqmta-ch2-06v.sys.comcast.net (resqmta-ch2-06v.sys.comcast.net [69.252.207.38])
        by email.exmaple.com (Postfix) with ESMTPS id F0A9D200C8
        for <s...@exmaple.com>; Tue, 30 Mar 2021 13:20:12 -0400 (EDT)
Received: from resomta-ch2-06v.sys.comcast.net ([69.252.207.102])
        by resqmta-ch2-06v.sys.comcast.net with ESMTP
        id RCA7l3lgvsjoSRI2ElIKl6; Tue, 30 Mar 2021 17:20:10 +0000
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=comcastmailservice.net; s=20180828_2048; t=1617124810;
        bh=EzUwkxtc+07gV+1cIeMVwIqhGkZuGI/a4ukUrCjG7nM=;
h=Received:Received:Received:Received:Received:Received:Received:
         Message-ID:Date:From:Reply-To:To:Subject:Mime-Version:
         Content-Type;
b=YTHf56FxVyphxJLrqEnfZKfP5M62QfSc0ICCe5ZS/2UXQUsumO0ltgCO6ZjDRxrso Up8oEgr4gqv8kNMAtJEM532f15eLObwwty+P0OAS8HncjfsiHJspdnk3Eg0aC4A57k 5w8gnpRbQoa/KaAn0bejQNcCdr+KArf6VwKO+q5/HY9UQxa2RxIWUsoxIMmyZX0WpF upTL1nKnd+zaRENmudAllcfxCLMUpnc9oK/Ea//4bcT/51ofrewbe/J0ZhaAUfJu5O /40UsSsWx49VFVQ1X7Bifw/CE56spoesfnOSm9/7W/V0PptjjleM6LIQ3S+xWRJFaS
         xfwTExYFqt5sw==
Received: from dovback2-asa-09o.email.comcast.net ([96.118.48.40])
        by resomta-ch2-06v.sys.comcast.net with ESMTP
        id RI2Dlb2J4RxAFRI2EldEBV; Tue, 30 Mar 2021 17:20:10 +0000
X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduledrudeitddgudduvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddunecundfotefknffkpffiucdludejmdenucfjughrpefkfffhrhfvuffjgggtsegrtderredttdejnecuhfhrohhmpedfjfhomhgvucghrghrrhgrnhhthicuqdcutefjufdfuceoshgvnhgusehfohhrghgvthhmrghsshhivhgvshdrtghomheqnecuggftrfgrthhtvghrnhepfeefffetveetheffvdfgieeuueehleffleeghfeuudffgeejhfeugfffgfeufeejnecuffhomhgrihhnpegslhhuvghhohhrnhgvthdrtghomhenucfkphepleeirdduudekrdegkedrgedtpdeijedrvdduiedrvddvgedrgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghlohepughovhgsrggtkhdvqdgrshgrqddtlehordgvmhgrihhlrdgtohhmtggrshhtrdhnvghtpdhinhgvthepleeirdduudekrdegkedrgedtpdhmrghilhhfrhhomhepsghouhhntggvqdhushgvpehmpeeggeeikedvjeefgeekfeeipegvtghhohegpeeiughftdgrkegtudeivdgtuggtvdekuddtuggtkegsgehfvgdtrgduudelkedujeesrhgvthhurhhnphgrthhhrdgslhhuvghhohhrnhgvthdrtghomhdprhgtphhtthhopehsseguohhnughlvgihrdgtohhm
X-Xfinity-CCat: promotional
X-Xfinity-VMeta: sc=17.00;st=mce
X-Sieve: Pigeonhole Sieve 0.5.12 (f22f7ab3)
X-Sieve-Redirected-From: steveexma...@comcast.net
Delivered-To: steveexma...@comcast.net
Received: from dovdir2-asa-02o.email.comcast.net ([69.252.207.53])
        by dovback2-asa-09o.email.comcast.net with LMTP
        id 6GaMGsZdY2AmPwAAmOiKAQ
(envelope-from <bounce-use=m=44682734836=echo4=6df0a8c162cdc2810dc8b4fe0a119...@returnpath.bluehornet.com>)
        for <steveexma...@comcast.net>; Tue, 30 Mar 2021 17:20:06 +0000
Received: from dovpxy-asb-13o.email.comcast.net ([69.252.207.53])
        by dovdir2-asa-02o.email.comcast.net with LMTP
        id iGWMF8ZdY2AdXwAAq9RwVw
(envelope-from <bounce-use=m=44682734836=echo4=6df0a8c162cdc2810dc8b4fe0a119...@returnpath.bluehornet.com>)
        for <steveexma...@comcast.net>; Tue, 30 Mar 2021 17:20:06 +0000
Received: from resimta-ch2-34v.sys.comcast.net ([69.252.207.53])
(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
        by dovpxy-asb-13o.email.comcast.net with LMTPS
        id yLhCFMZdY2D5eQAAV/MBng
(envelope-from <bounce-use=m=44682734836=echo4=6df0a8c162cdc2810dc8b4fe0a119...@returnpath.bluehornet.com>)
        for <steveexma...@comcast.net>; Tue, 30 Mar 2021 17:20:06 +0000
Received: from smtp.liberal.bluehornet.com ([67.216.224.40])
        by resimta-ch2-34v.sys.comcast.net with ESMTP
        id RI22lqxlK2vXGRI29lQ6xW; Tue, 30 Mar 2021 17:20:06 +0000
X-Xfinity-Message-Heuristics: IPv6:N;TLS=1;SPF=1;DMARC=
Authentication-Results: resimta-ch2-34v.sys.comcast.net;
dkim=pass header.d=forgetmassives.com header.i=@forgetmassives.com
 header.b=Cc3SOvHE
X-MSFBL: c3RldmVkb25kbGV5QGNvbWNhc3QubmV0QGJlcm5hcmRfbGliZXJhbEBiZXJuYXJk
        QGJvdW5jZS11c2U9TT00NDY4MjczNDgzNj1lY2hvND02REYwQThDMTYyQ0RDMjgx
        MERDOEI0RkUwQTExOTgxNw==
DKIM-Signature: v=1; a=rsa-sha256; d=forgetmassives.com; s=s1024-1.bh; c=simple/simple;
        q=dns/txt; i=@forgetmassives.com; t=1617124756;
h=From:Subject:Date:To:Mime-Version:List-Unsubscribe:List-Unsubscribe-Post:Content-Type;
        bh=v0lCvbtRqApG1XU1/ouMo37AJee75nZOebhHsT2gjbw=;
b=Cc3SOvHEcyP4NtvbU8vbw/j8DZPj9Cyd5Aw6l3XX1J8YDiJ/qk2Im4rmgzw7eBIz
        cjwPM9nPlEG30CU7033+PruH+O/lL5Es5TDUXBICgEJ8MzAFSS6FBz/J2dfygBLw
        NnSJvpGkQG8f/M1CQW4DpF5+cB9yBlE2+c+heD8vEeA=;
Received: from [172.16.9.190] ([172.16.9.190:44982] helo=localhost.localdomain) by returnpath.bluehornet.com (envelope-from <bounce-use=M=44682734836=echo4=6df0a8c162cdc2810dc8b4fe0a119...@returnpath.bluehornet.com>)
        (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTP
        id B3/BE-10603-49D53606; Tue, 30 Mar 2021 10:19:16 -0700
Message-ID: <B3.BE.10603.49D53606@emsmta18>
Date: Tue, 30 Mar 2021 05:18:34 -0700
From: "Home Warranty - AHS" <s...@forgetmassives.com>
Reply-To: s...@forgetmassives.com
To:  <steveexma...@comcast.net>
X-Outgoing: bernard
Subject: It's getting warmer, are you covered?
List-Unsubscribe: <mailto:unsub-44682734836-echo4-6df0a8c162cdc2810dc8b4fe0a119...@listunsub.bluehornet.com>
Mime-Version: 1.0
Content-Type: multipart/alternative;
    boundary="--6063171a83296-MultiPart-Mime-Boundary"



----6063171a83296-MultiPart-Mime-Boundary
Content-Type: text/plain; charset="utf-8"
Content-Disposition: inline
Content-Transfer-Encoding: 8bit



Your AHS Home Warranty covers the repair or replacement of many
system and appliance breakdowns, but not necessarily the entire
system or appliance. Please refer to your contract for details.

                    American Home Shield 150 Peabody Pl.,
Memphis, TN 38103.
                    Unsubscribe | Privacy Policy
                    © 2021 American Home Shield Corporation. All
rights reserved.

This message was intended for: steveexma...@comcast.net
You were added to the system October 20, 2020.
For more information please follow the URL below:
http://echo4.bluehornet.com/p/iT5IWP_2NK

Follow the URL below to update your preferences or opt-out:
http://echo4.bluehornet.com/p/oT5IWP_2NK

To unsubscribe from future mailings, send an email to mailto:unsub-44682734836-echo4-6df0a8c162cdc2810dc8b4fe0a119...@emailsendr.net?Subject=Unsubscribe&body=Please%20remove%20me%20from%20further%20mailings
with "Unsubscribe" as the subject line.



----Powered by DMLS----






----6063171a83296-MultiPart-Mime-Boundary
Content-Type: text/html; charset="utf-8"
Content-Disposition: inline
Content-Transfer-Encoding: 8bit



<html><!--

*******************************************************
*Note: If you are having trouble viewing this message,*
*copy and paste the link below into your browser      *
*address field and hit the Enter button on your       *
*keyboard.                                            *
http://echo4.bluehornet.com/p/vT5IWP_2NK
 If you would like to change your preferences         *
 or unsubscribe, copy the URL below:                  *
This message was intended for: steveexma...@comcast.net
You were added to the system October 20, 2020.
For more information please follow the URL below:
http://echo4.bluehornet.com/p/iT5IWP_2NK

Follow the URL below to update your preferences or opt-out:
http://echo4.bluehornet.com/p/oT5IWP_2NK

To unsubscribe from future mailings, send an email to mailto:unsub-44682734836-echo4-6df0a8c162cdc2810dc8b4fe0a119...@emailsendr.net?Subject=Unsubscribe&body=Please%20remove%20me%20from%20further%20mailings
with "Unsubscribe" as the subject line.


*******************************************************
 -->
<html dir="ltr"><head><title></title></head><body><table width="620" align="center"> </table><table align="center"> <tbody><tr><td align="center"><a href="http://echo4.bluehornet.com/ct/100057356:T5IWP_2NK:m:1:3292882242:C5DB59115FB99008217C5611CDEF14ED:r";><img src="https://newbukett.s3.amazonaws.com/AHS_0325/Spring/AHS_Spring_2019_1.png"; alt="" width="620" height="1310" border="0" /></a></td></tr><tr><td width="600" align="center"><p><font size="2" face="Arial" color="#697080"><br /> Your AHS Home Warranty covers the repair or replacement of many system and appliance breakdowns, but not necessarily the entire system or appliance. Please refer to your contract for details. <br /><br /> American Home Shield 150 Peabody Pl., Memphis, TN 38103. <br /><a href="http://echo4.bluehornet.com/ct/100057357:T5IWP_2NK:m:1:3292882242:C5DB59115FB99008217C5611CDEF14ED:r";>Unsubscribe</a> | <a href="http://echo4.bluehornet.com/ct/100057358:T5IWP_2NK:m:1:3292882242:C5DB59115FB99008217C5611CDEF14ED:r";>Privacy Policy</a><a> <br />&copy; 2021 American Home Shield Corporation. All rights reserved. </a></font></p></td></tr></tbody></table> <br /><br /><br /><br /></body>

<p><font face="Verdana, Arial, Helvetica, sans-serif" size="1" color="#999999"> This message was intended for: <a href='mailto:steveexma...@comcast.net'>steveexma...@comcast.net</a> <br />
            You were added to the system October 20, 2020.<br />
For more information <a href='http://echo4.bluehornet.com/p/iT5IWP_2NK'>click here</a>. <a href='http://echo4.bluehornet.com/p/oT5IWP_2NK'>Update your preferences</a><br /> <a href='http://echo4.bluehornet.com/p/oT5IWP_2NK'>Unsubscribe</a> | <a href='mailto:unsub-44682734836-echo4-6df0a8c162cdc2810dc8b4fe0a119...@emailsendr.net?Subject=Unsubscribe&body=Please%20remove%20me%20from%20further%20mailings'>Unsubscribe via email</a><br />
            <br />
</font></p><br><br><a href=""><img src="http://echo4.bluehornet.com/skins/329d6fe2ad79accb/powered_by.jpg"; border="0"></a></b></font></p><img src="http://echo4.bluehornet.com/imagelibrary/N-T5IWP_2NK-72D5B94E3EAF68018D90DE9FBDD9E339.jpg"; width="1" height="1" style="border:none; visibility:hidden; max-height:0px; max-width:0px; overflow:hidden;">

</html>



----6063171a83296-MultiPart-Mime-Boundary--

------------=_60635DCD.A0F5D194--

Reply via email to