change the file, it was
still locked and wouldn't allow me.
I did look at /usr/local/mysql/bin/sqlLines and it is empty.
When I first open terminal this is what I get:
Joseph-Kosinskis-MacBook:~ josephkosinski$
What should I do to change to a directory own
Try this one:
SELECT a.username, a.first_name,
a.last_name,COALESCE(COUNT(b.username), 0) AS count
FROM user_list a
LEFT JOIN login_table b ON a.username = b.username
GROUP BY a.username,a.first_name,a.lastname;
The LEFT JOIN will ensure you still get a result row even if there are
no match
On Jan 30, 2008, at 10:44 AM, Jerry Schwartz wrote:
mysqldump -A > file.dump
tar -jcf file.dump
rsync
[JS] You could also just pipe the output of mysqldump through gzip.
tar buys
you nothing, since it is a single file.
-j is the bzip2 compression option. :)
[JS] Yes, but tar is just extra b
Is there a reason this wouldn't work with InnoDB? (I understand
there's usually a single ibdata file, but so?)
On Jan 24, 2008, at 8:08 AM, Matthias Witte wrote:
On Thu, Jan 24, 2008 at 01:42:38PM +0200, Ivan Levchenko wrote:
Hi All,
What would be the best way to transfer a 20 gig db from
On Jan 29, 2008, at 10:02 AM, Jerry Schwartz wrote:
mysqldump -A > file.dump
tar -jcf file.dump
rsync
[JS] You could also just pipe the output of mysqldump through gzip.
tar buys
you nothing, since it is a single file.
-j is the bzip2 compression option. :)
--
MySQL General Mailing List
On Jan 29, 2008, at 6:21 PM, BJ Swope wrote:
drop the indexes for the conversion then rebuild the indexes after the
tables are converted.
As noted in my original email, I tried that, but Jan's suggestion re:
InnoDB tuning fixed it.
Thanks for the advice, everyone!
David
--
MySQL General
On Jan 29, 2008, at 7:04 PM, Jan Kirchhoff wrote:
play around with innodb_log_buffer_size, innodb_log_file_size and
try to set innodb_flush_log_at_trx_commit=0.
Do you don't have a BBU on your raid-controller?
let me know if that changes anything.
That did it! I upped the log_buffer_size
On Jan 29, 2008, at 6:09 PM, Jan Kirchhoff wrote:
what hardware are you running on and you much memory do you have?
what version of mysql?| |
How did you set innodb_buffer_pool_size?
Hardware:
Dual AMD Opteron 246 2.0 GHz
4 GB DDR RAM (no swap being used)
Dual 146 GB SCSI drives with a RAID
On Jan 29, 2008, at 4:37 PM, Baron Schwartz wrote:
It's because your index is bigger than your memory (or at least bigger
than your InnoDB buffer pool). InnoDB can't build indexes by sorting
rows, so building the indexes gets slow.
Hmm, this would be an interesting theory for the main table i
Hi all,
I am attempting to convert a very large table (~23 million rows) from
MyISAM to InnoDB. If I do it in chunks of one million at a time, the
first million are very fast (approx. 3 minutes or so), and then it
gets progressively worse, until by the time I get even to the fourth
chunk
t.
Yes, it's dumb.
On Nov 7, 2007, at 2:53 AM, Lucky Wijaya wrote:
No, I didn't set the delimiter. But, it still have an error after I
set delimiter in my trigger as your example. By the way, what's
delimiter mean ? And what it's for ?
Thanks to you Mr. David.
David
Lucky,
Did you make sure to set your delimiter before and after the CREATE
TRIGGER statement? e.g.:
DELIMITER ;;
CREATE TRIGGER DEL_TB_INSTRUKSI AFTER DELETE ON Tb_Instruksi
FOR EACH ROW
BEGIN
DELETE FROM Tb_Stuffing WHERE No_Instruksi = OLD.No_Instruksi;
END;;
DELIMITER ;
On Nov 6, 2007
/bugs.mysql.com/bug.php?id=16927
This occurred shortly after the server ID conflict, and exactly when
the master was melting down.
David
On Sep 14, 2007, at 4:11 AM, Jeremy Cole wrote:
Hi David,
This sounds strange, and should NOT occur because of a server_id
conflict.
Regards,
Jeremy
Da
, Shawn Green wrote:
Hello David,
David Schneider-Joseph wrote:
Hi all,
What do you know about the effect of conflicting slave server IDs
on the master in general? And specifically, are you aware of any
issues with MySQL 5.0.27?
Your help is very much appreciated.
Thanks!
David
Repeating
Hi all,
What do you know about the effect of conflicting slave server IDs on
the master in general? And specifically, are you aware of any issues
with MySQL 5.0.27?
Your help is very much appreciated.
Thanks!
David
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/m
Try this:
SELECT RMAs.rma_id FROM RMAs, rma_line_items
WHERE TO_DAYS(date_settled) = 733274
AND RMAs.rma_id = rma_line_items.rma_id
GROUP BY RMAs.rma_id HAVING COUNT(*) > 1
On Sep 10, 2007, at 11:36 PM, Mike Mannakee wrote:
I have two tables, one called RMAs and the other called
rma_line_item
Hi all,
Starting Wednesday night, we observed several weird errors indicative
of data corruption shortly before a CPU spike and complete crash on
our master db server (opera.oursite.com). opera.oursite.com had
crashed twice with signal 11 in recent weeks, but we had never
observed any data corrup
> Baron Schwartz wrote:
>> Hi Joseph,
>>
>> Joseph Koenig wrote:
>>> Hi,
>>>
>>> I'm running MySQL 5.0.27-standard-log on RHEL 4. After install, I
>>> moved the
>>> data directory of MySQL. I updated everything that SELinux
> Hi,
>
> CA Lists wrote:
>>> Hi Joseph,
>>>
>>> Joseph Koenig wrote:
>>>> Hi,
>>>>
>>>> I'm running MySQL 5.0.27-standard-log on RHEL 4. After install, I moved the
>>>> data directory of MySQL. I updated e
;s driving me nuts. Is there any way to
create the necessary tables now so that MySQL does actually start logging
everything they way it should be able to and also will make these errors go
away? Thanks in advance,
Joe
--
Joseph Koenig
Creative Anvil, Inc.
Ph: 314.773.2611
FX: 314.773.2
May 31, 2006 12:25:50 PM CDT
To: "Joseph Alotta" <[EMAIL PROTECTED]>
Cc: mysql@lists.mysql.com
Subject: Re: please help optimize this query
I'd start by looking at your schema.. Quite a lot of use of
varchars... I'd suggest using chars (takes more space but processes
fas
Greetings,
I generate this report of all the holdings by symbol, summing up over
accounts. It is taking much too long. I was wondering if I can add
an index on something to make it more efficient. The first query
gets the most recent date, the next query sums it up by symbol.
Thank you
FreeBSD / UNIX platform, MySQL ver.4.0.16
Prob. of growing /tmp file, solved by introducing a cron job to clean up
the folder intermittently. Prob.solve but new one created - mysql socket
wiped out. Could not restart the server with all the standard methods.
Complained of other running processes.
greetings,
I know this is pretty basic stuff, but I couldn't find an answer in
google.
1. I want to set the @maxdate variable, but mysql complains. What am
I doing wrong?
2. The 3rd to the last line:
and (p.value - t.amount) < -1000
I wanted to say
diff < -1000
but mysql
Greetings,
Thank you Dahl and Xiaobo. Here it is working for all to see. I
particularly like that it doesn't try to use a key again once it is
deleted.
Joe.
mysql> use names;
Database changed
mysql> create table people ( id mediumint unsigned not null
auto_increment,
-> first
Greetings,
I have a bunch of names and addresses that I am adding to MySql
database. I would like to automatically assign a unique sequence
number to each person. Is there a way to do this easily?
idname
1 bob jones
2 larry smith
3 henry rogers
Thanks for you help,
Jo
Shawn, Glen, and everyone else,
Thank you very much! I do believe that I have enough material to work
on it now!
I appreciate your help very much!
Joseph "Tito" Kraer
Business Systems Analyst
Taylor, Bean & Whitaker Mortgage Corp
-Original Message-
From: Gleb Paharenko
. Then, I need to look into other tables to fill
those columns. This is what I need help with: how do I generate those
columns? I guess they could be generated separately and then I could
put both of my outputs together. Unfortunately, time is running out.
TIA,
Joseph "Tito" Kraer
Busine
_sta_id != "5"
OR eventum_issue.iss_sta_id != "6"
OR eventum_issue.iss_sta_id != "9")))
ORDER BY eventum_issue.iss_id
Please, I don't need comments telling me that I'm missing the semicolon
or that comments such as "doesn&#
quot;6"
OR eventum_issue.iss_sta_id != "9")))
ORDER BY eventum_issue.iss_id
Please, I don't need comments telling me that I'm missing the semicolon
or that comments such as "doesn't work" are worthless. I know there's
something
Thank you, Shawn, for understanding what I meant and for explaining the
issue so clearly. I apologize to all others if I wasn't clear enough,
but, yes, I wanted to update two separate rows. Now, I understand why
an OR is needed; I'll study the other option too.
Thank you,
Jo
x27;t
work. What am I doing wrong?
Thanks in advance,
Joseph "Tito" Kraer
Business Systems Analyst
Taylor, Bean & Whitaker Mortgage Corp
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/mysql
To unsubscribe:http://lists.mysql.com/[EMAIL PROTECTED]
Thank you for your help, Shawn. I had to dig a little, but I found the
way to set the global variable to a larger size and was able to complete
my restore.
I may yet get the hang of this. :-)
Joseph "Tito" Kraer
Business Systems Analyst
Taylor, Bean & Whitaker
ell> mysql -uusername -ppassword eventum < sourcefile.sql. The
process also bombs out if I try to use MySQL Administrator.
Any suggestions?
Joseph "Tito" Kraer
Business Systems Analyst
Taylor, Bean & Whitaker Mortgage Corp
1417 N Magnolia Avenue
Ocala, FL 34470
Ph. 352-671-0678
Fax 352
overy to 3 to
>
> bring the database up without the rollback, then DROP the table that is
>
> causing the runaway rollback):
>
> http://dev.mysql.com/doc/mysql/en/forcing-recovery.html
>
>
>
>
>
>
>
> Joseph Cochran <[EMAIL PROTECTED]> w
ur own...
>
> That's a LOT of data...
>
> Also.. if the kill works you could still delete in the future but put a
> LIMIT on the delete clause. This way you can determine how long your
> delete's will take.
>
> Kevin
>
> On 9/6/05, Joseph Coch
Here's the situation. I have a table of about 900 million rows, consisting
of a bigint and an int in each row. There's an index on the bigint. The
table is referenced in a SELECT in other DB operations roughly 15 or 20
times per day.
We're under tight deadlines and some operations on the table
Some countries have multiple timezones, so it is not sufficient to
know the country code in order to get the timezone. If they have
previously posted the timezone, however, then it should be possible to
store that information in a cookie on the client machine that your web
layer can retrieve. If yo
www.mysql.com/doc
search drop index
Eric Jensen wrote:
I have a field that was set as a unique key when created via:
UNIQUE KEY `username` (`username`)
I no longer want it unique, but can't see a way with ALTER TABLE to
remove it. It isn't the Primary Key or an index. The describe looks
lik
ne how efficient your indexes are. Using a lot of
>
> keys could slow down the INSERT operations but fasten the SELECTs.
>
> InnoDB monitors might be helpful in your case as well. See:
>
> http://dev.mysql.com/doc/mysql/en/explain.html
>
> http://dev.mysql.co
So here's my situation: we have a database that has a table of about 5
million rows. To put a new row into the table, I do an INSERT ...
SELECT, pulling data from one row in the table to seed the data for
the new row. When there are no active connections to the DB other than
the one making the INSE
We've been using mysql version 4.7 on a FreeBSD 4.10 machine for the
past few months, and while we've been putting a lot of load onto the
DB, it's been stable. This past weekend, our sysadmin updated FreeBSD
from 4.10 to 4.11, at which point mysql began having serious problems.
The DB itself is fin
atabase is pretty much inaccessible until mysqlimport completes.
-Original Message-
From: [EMAIL PROTECTED]
[mailto:[EMAIL PROTECTED]
Sent: Monday, March 28, 2005 12:30 AM
To: [EMAIL PROTECTED]
Subject: Re: mysqlimport blocks all access to database
Hi Joseph,
> I have been trying to us
I have been trying to use mysqlimport to load a primarily read only
database with data at regular intervals. My problem occurs when my
tables are myisam. In this case all access to the database and the
tables blocks until mysqlimport completes. The -lock-tables=false
parameter does not help. Is th
Also, check to make sure the partition where your log directory is (ie.
/var) isn't full.
Move, compress, or delete some of the old logs, then restart mysql server.
Reconfigure your log rotation scheme to avoid this in the future.
HTH,
Joey
~~
Joseph Kar
I had written a windows app using the C api that used
the embedded server for 4.0.18, and it worked fine. Now I am trying to upgrade
to 4.1.9, and it is not working. When I hit the statement mysql_real_connect,
it gpf's. This behaviour is the same as what I experience when I try to run the
A pain replying to digest in digest mode, change mode to normal
Warning messages, as from a mysqlimport command, where are they to be
found?
Part of the construct from a cron job script file run at the command
line interface
$ /usr/local/bin/mysqlimport -v -l --fields-terminated-by="
Warning messages, where are they to be found?
Part of the construct from a cron job script file run at the command
line interface
$ /usr/local/bin/mysqlimport -v -l --fields-terminated-by="|"
--local fisheries -L -u administr -p $CRONBASE/trawler.tmp
Connecting to localhost
On Mon, 23 Aug 2004 15:25:21 +0200, Martijn Tonies <[EMAIL PROTECTED]> wrote:
> > > I have a questions about "varchar columns" change to "CHAR columns"
> > > automatically.
> > See http://dev.mysql.com/doc/mysql/en/Silent_column_changes.html
> In addition to that - it doesn't really matter as th
I am moving my database(s) from one server to another, did a full dump
of the data and have a large file with all the create instruction sets etc.
My question, what is the best way to recreate these db, tables etc. on
the new server. MySQL is already installed & running.
Thanks
--
MySQL General
On Mon, Jul 12, 2004 at 05:28:04PM +0300, Heikki Tuuri wrote the following:
> Ian,
>
> note that the MySQL mailing list is also forwarded to the
> mailing.database.myodbc Usenet group, as well as to several mailing list
> archiving websites. Spam robots and viruses have plenty of places from which
Group,
I have a project where I need to move a 4.x database to 3.x database. Are
there any issues with doing the following:
mysqldump 4.x
mysqladmin create 3.x database
mysql 3.x database < 4x.dump
Thanks.
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/mysql
To uns
Group,
First of all thanks to anyone who can respond to this - I am really stumped.
I have been trying to figure this one out and maybe someone out there with a
little deep understanding of joins in sql can give me a hand.
I am working on a system that creates these sql statements on the fly
to this question I can probably figure out the
rest. But I can't afford to spend the time trying to get it right and
turn up nothing.
Thanks!
- Joe
--
=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=
[ Joseph Monti]
[ [EMAIL PROT
- Joe
--
=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=
[ Joseph Monti]
[ [EMAIL PROTECTED] ]
[ http://www.smartrobots.com/ ]
=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=
--
MySQL General Mailing List
For list archives:
t I definitely come to a grinding halt when I
> try to reach www.mysql.com. I can't do a tracert because the university
> has shut that off here. But I guess it is working for everyone else.
www.trace-route.org ;)
--
Joseph A. Nagy, Jr. http://joseph-a-nagy-jr.homelinux.org
Political
The PHP page that was being reported at being in error wasn't the one in
error.
Sorry for wasting everyone's bandwidth and time.
--
Joseph A. Nagy, Jr. http://joseph-a-nagy-jr.homelinux.org
Political Activist Extraordinaire Peace, Life, Liberty
"The only fallacy is the
hp to / for the vhost and it still wants
to try and use [EMAIL PROTECTED] instead of what is defined in my
dbconnect file. I'm out of idea's and am no longer sure this is a mysql
problem but I don't know where else to go. ):
--
Joseph A. Nagy, Jr. http://joseph-a-nagy-jr.homelinux.or
db so
completely?
--
Joseph A. Nagy, Jr. http://joseph-a-nagy-jr.homelinux.org
Political Activist Extraordinaire Peace, Life, Liberty
"The only fallacy is the inaction on our part to stave off the worst of
horrors, the stripping of personal freedom." -- Joseph A. Nagy, Jr. January 2004
On Fri, Apr 16, 2004 at 12:07:39AM -0400, Mark Susol | Ultimate Creative Media wrote
the following:
> On 4/15/04 11:46 PM, "Joseph A. Nagy, Jr."
> <[EMAIL PROTECTED]> wrote:
>
> > So I'm using PHP and MySQL to serve up a game and all is going well until
&g
o I look to fix it?
--
Joseph A. Nagy, Jr. http://joseph-a-nagy-jr.homelinux.org
Political Activist Extraordinaire Peace, Life, Liberty
"The only fallacy is the inaction on our part to stave off the worst of
horrors, the stripping of personal freedom." -- Joseph A. Nagy, Jr. Ja
Hi,
is it (mysql v5.0) or might it once be possible, to 'return' a cursor as an out
parameter from a stored procedure?
In MS SQL Server a stored procedure can return a 'recordset' by simply defining a
select statement. In ORACLE one can define a ref cursor output parameter and 'fill' it
within t
th of which work from my command line.
Neither of the above worked for me with the possible exception of the user
field as I had not had any problems with it. That's okay though as I'm now
having problems with the mysqlaccess command.
--
Joseph A. Nagy, Jr. http://joseph-a-nagy-jr.homeli
On Sun, Apr 11, 2004 at 06:34:28PM -0500, Joseph A. Nagy, Jr. wrote the following:
> Problem solved. ):
Well, it wasn't a problem with mysql per sey but a problem with how I was
entering the command.
The man page says
/usr/bin/mysqladmin -u user -p somepassword
is correct as is
Problem solved. ):
--
Joseph A. Nagy, Jr. http://joseph-a-nagy-jr.homelinux.org
Political Activist Extraordinaire Peace, Life, Liberty
"The only fallacy is the inaction on our part to stave off the worst of
horrors, the stripping of personal freedom." -- Joseph A. Nagy, Jr. Ja
Okay, I've been googling for about half an hour, found several useful links
but I'm still having a problem with the password for the initial mysql db
that is created when you follow the install instructions.
Here is the problem I'm having:
joseph-a-nagy-jr root # /usr/bin/mysqla
how do I get the digest form instead of individual emails?
-
Do you Yahoo!?
Yahoo! Search - Find what youre looking for faster.
is appreciated and thanks in advance.
Jacob Joseph.
---
Outgoing mail is certified Virus Free.
Checked by AVG anti-virus system (http://www.grisoft.com).
Version: 6.0.588 / Virus Database: 372 - Release Date: 2/13/04
is appreciated and thanks in advance.
Jacob Joseph.
---
Outgoing mail is certified Virus Free.
Checked by AVG anti-virus system (http://www.grisoft.com).
Version: 6.0.588 / Virus Database: 372 - Release Date: 2/13/04
--
MySQL General Mailing List
For list archives: http://lists.mysql.com
-+
| structure_aa_seq |
+--+
| GGFVPNWYQHPDPALKYADDMEVYDYYQQYEAAKKAAREASTSSKKTAATSPALPRAKPHVTIA |
+--+
Thanks
Joseph S. Brunzelle, Ph.D.
Life Sciences CAT
Dept of Mol. Pharm. and Biol. Chem.
Feinberg School of Medicine
Northwestern University
Phone (6
se returns error 127.
How can I correct this? Drop and create is ok and is What I am doing now.
Jacob Joseph
NGL Solutions Pvt. Ltd.
2nd Floor, Thoppil Estate, Janatha Junction,
SA Road, Vyttila,
Ernakulam - 682 019.
Phone: 91-484-2302 385, 2302 386.
Email: [EMAIL PROTECTED]
mount vxfs snapshot.
3. From the first client, execute: UNLOCK TABLES.
4. Copy files from snapshot.
5. Unmount snapshot. "
(from : http://www.mysql.com/doc/en/Backup.html)
Bernard
Hope this helps,
Joseph Bueno
On Tuesday 18 November 2003 05:12, Simon Green wrote:
Has any one use LVM to
MyISAM tables can be larger than 4Gb without using merge tables.
This topic has been discussed several times on this list.
You will find all details in "Google groups" archive:
http://groups.google.com/groups?q=myisam+4Gb+limit+group:mailing.database.mysql&scoring=d
Hope this helps
[EMAIL PROTECTED] wrote:
Thanks Joseph.
I just to another look at the query and it actually takes 65 seconds on the
first run, not 10 seconds, so this is important for me to understand.
So my next questions are:
Is there any way to tune the OS file system cache?
This is very OS system dependent
There is caching but it is at OS level: on first query, data are
fetched from disk; other queries read directly from file system cache.
Hope this helps
Joseph Bueno
[EMAIL PROTECTED] wrote:
Hi everyone. I'm using MySQL 4.0.16 with W2K/SP4 on a 512KB RAM/1.2GHz
Athlon machine (my dev workst
ciently. In addition,
openMosix doesn't currently offer support for allowing multiple
cooperating threads to be separated from one another. "
Since mysql is a single multithreaded process, you should not expect any
performance increase :(
--
Joseph Bueno
--
MySQL General Mailing List
Have you tried:
select commentref,max(commentid)
from comments
group by commentref
Regards,
Joseph Bueno
Cummings, Shawn (GNAPs) wrote:
This doesn't seem to be making sure that the "newest" commentid is the
result... Seems to be random.
At 09:11 AM 10/6/2003 -0400, you wrote
Dear All ,
A few tables of my database crashed and are not getting repaired .What is
the best way to recover the data .
Any suggestion will be of great help .
Regards
Stanley Joseph
+44 (0) 208 665 4291 (W)
+44 (0) 777 621 0132 (M)
http://www.themobilerepublic.com
The Price, The Choice, The
mysql
bye
Waseem Ahmad Zia
Subqueries and prepared statements are not available in 4.0.15.
They will be in 4.1
Check the manual for details :
http://www.mysql.com/doc/en/ANSI_diff_Subqueries.html
http://www.mysql.com/doc/en/C_API_Prepared_statements.html
Regards,
Joseph Bueno
--
MySQL General
I can not make heads or tails out of what it is trying to tell me, or
where the ./mysql/host.frm file is. Does anyone know?
Joseph Donato
-- Joseph Donato RUCS-NB Help Desk [EMAIL PROTECTED]
732-445-8706 "A witty saying proves nothing, but saying something
pointless gets people'
this.
Joseph Donato
______
Joseph E. Donato
New Brunswick Computing Services
RUCS-NB Help Desk
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/mysql
To unsubscribe:http://lists.mysql.com/[EMAIL PROTECTED]
in
buffer :(
Regards,
Joseph Bueno
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/mysql
To unsubscribe:http://lists.mysql.com/[EMAIL PROTECTED]
(5,2) is
-99.99 to 99.99 (although mysql MAY accept some values beyond these
limits).
Since your values are clearly out of this range, you should revue your
field specification.
Maybe DECIMAL(7,2) would be better ?
Hope this helps
Joseph Bueno
--
MySQL General Mailing List
For list archives: http://l
Hello - I've got a simple MySQL/PHP database set up with 3 tables plus a
"relationship" table (using phpMyAdmin.) The end result is for students to
be able to dynamically find out what books are required for their classes by
selecting; term ---> course ---> instructor ---> (results)
The tables l
Hello - I've got a simple MySQL/PHP database set up with 3 tables plus a
"relationship" table (using phpMyAdmin.) The end result is for students to be able to
dynamically find out what books are required for their classes by selecting; term --->
course ---> instructor ---> (results)
The table
Since your primary key is used, maybe you should consider adding an
index on PostedZpdi field only.
You may also check 'key_buffer_size' value (show variables like 'key%').
Since your primary key is more than 200 MB big, allocating a "big" key
buffer (> 256M
15540 |678 | 2180988928
|NULL |530350080 | 0 | NULL | NULL | NULL
| NULL || InnoDB free: 142368768 kB |
Hi,
What do you get when you do an EXPLAIN of your query ?
--
Joseph Bueno
--
MySQL General Mailing List
For list archives:
o a record in another
and do queries that pull from both databases?
Thanks,
Jeff
Hi,
Yes you can do that. Just prefix table name with database name in your
query:
select *
from table1,database2.table2
where table1.field1=database2.table2.field2
Hope this helps,
Joseph Bueno
--
MySQL General Ma
This version makes the startup and shutdown of MySQL Server on RedHat systems look
prettier. Perhaps the development team would consider using it? 8-D
It is in unified patch format.
Joseph Wagner
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/mysql
To unsubscribe
Deependra b. Tandukar wrote:
Dear all,
what is the meaning of
Can't open file: 'products_description.MYI'. (errno: 145)
in mysql?
Regards,
_DT
$ perror 145
145 = Table was marked as crashed and should be repaired
Hope this helps
--
Joseph Bueno
--
MySQL General Mailing List
Fo
254'
10 points to the one whos knows how to do a query like that.
select * from mydata
where mystring regexp '[A-Z]*1[A-Z]*2[A-Z]*5[A-Z]*4[A-Z]*';
should do it.
Regards
Joseph Bueno
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/mysql
To unsubscribe:http://lists.mysql.com/[EMAIL PROTECTED]
+
| from_unixtime(unix_timestamp('2003-08-26')) |
+-+
| 2003-08-26 00:00:00 |
+-----+
rt3=# select age(now(),'2003-08-26'::timestamp);
age
I have a table I use to keep track of referred users on my top list. Below
you will find the four columns in my table. What I need to do is keep
entries (rows) unique based on the linkid, ipaddress, and the clicktype so
that a user is not counted twice if they enter my site. Can someone tell
me wha
may be possible to adapt my approach to do it.
PS: I use mysql 3.23, mysql 4.x has a "LOAD DATA FROM MASTER"
that makes it much easier ;)
Hope this helps,
Joseph Bueno
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/mysql
To unsubscribe:http://lists.mysql.com/[EMAIL PROTECTED]
Hello,
Could someone recommend a decent php script that could be used for
database[MySQL]::Web interfacing and management. Preferably open source,
freeware or otherwise [I'll just have to grin & bare it]
Thanks
-- Joe --
--
MySQL General Mailing List
For list archives: http://lists.mysql.co
uestion is whether that port requires
TCP,
UDP or both to be open.
Thanks!
David Christensen
Brokers International, Ltd.
1200 E Main St
Panora, IA 50216
(641) 755-2775
[EMAIL PROTECTED]
TCP only
Joseph Bueno
--
MySQL General Mailing List
For list archives: http://lists.mysql.com/mysql
To unsubscrib
are the options that I have to speed my queries on the mysql side with
regards to the my.cnf file. I have a fair understanding of
sql optimization and I understand explain. I just want to see if
there is something that I can do with the server also.
Thanks to all.
#Joseph Norris (Perl - what else
select database();
Regards,
Joseph Bueno
Vinay wrote:
Is there an SQL command that i can perform which will return me the name
of the Database i'm currently conected to.
Thanks for your help.
Vinay
--
http://www.uptoten.com - The fun place to learn on-line
UpToTen Kids : 600 educational
Hello,
I am uploading records from a user data entered log file with
mysqlimport on a periodic basis. I would like to prevent the duplication
of records to keep the system non-redundant. How can I best achieve
this?
Thanks.
-- Joe --
--
MySQL General Mailing List
For list archives: http://l
select order by abs(field) desc;
Hope this helps,
Joseph Bueno
Martin Moss wrote:
All,
I have a question about grouping numbers.
Lets say I have 10 records each containing a numeric value:-
1
2
3
5
10
-1
-2
-3
-4
-5
What I wish to do is to select the records from the database but group
1 - 100 of 455 matches
Mail list logo
